Gene Gene information from NCBI Gene database.
Entrez ID 10365
Gene name KLF transcription factor 2
Gene symbol KLF2
Synonyms (NCBI Gene)
LKLF
Chromosome 19
Chromosome location 19p13.11
Summary This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in
miRNA miRNA information provided by mirtarbase database.
376
miRTarBase ID miRNA Experiments Reference
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT023028 hsa-miR-124-3p Microarray 18668037
MIRT006372 hsa-miR-92a-3p Other 21768538
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
FOXO1 Unknown 23002242
HNRNPD Unknown 15835916
NANOG Activation 22378194
TP53 Repression 23202365
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 26299712
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin IMP 22327366
GO:0000785 Component Chromatin ISA
GO:0000902 Process Cell morphogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602016 6347 ENSG00000127528
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5W3
Protein name Krueppel-like factor 2 (Lung krueppel-like factor)
Protein function Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription (PubMed:21063504). Might be involved in transcriptional regulation by modulating the binding of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 272 296 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 302 326 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 332 354 Zinc finger, C2H2 type Domain
Sequence
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  FoxO signaling pathway
Apelin signaling pathway
Fluid shear stress and atherosclerosis
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs7248864 RCV005917205
Inherited Immunodeficiency Diseases Likely pathogenic, low penetrance rs2512600587 RCV002306237
Malignant lymphoma, large B-cell, diffuse Benign rs7248864 RCV005917207
Malignant tumor of esophagus Benign rs7248864 RCV005917206
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Inhibit 24107715
Adenomatous Polyposis Coli Associate 38073344
Atherosclerosis Associate 17244683, 26372274, 30881601
Autoimmune Diseases Associate 36466816
Breast Neoplasms Associate 20132413, 31378902, 36100919, 39796183
Carcinogenesis Associate 37147883
Carcinoma Hepatocellular Associate 26336870, 34564989, 36177006, 37386390
Carcinoma Hepatocellular Inhibit 32318691
Carcinoma Non Small Cell Lung Inhibit 25501704
Carcinoma Non Small Cell Lung Associate 35587058