Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10365
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF2
Synonyms (NCBI Gene) Gene synonyms aliases
LKLF
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT006372 hsa-miR-92a-3p Luciferase reporter assay 21768538
MIRT023028 hsa-miR-124-3p Microarray 18668037
MIRT006372 hsa-miR-92a-3p Other 21768538
Transcription factors
Transcription factor Regulation Reference
FOXO1 Unknown 23002242
HNRNPD Unknown 15835916
NANOG Activation 22378194
TP53 Repression 23202365
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 26299712
GO:0000785 Component Chromatin IMP 22327366
GO:0000785 Component Chromatin ISA
GO:0000902 Process Cell morphogenesis IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602016 6347 ENSG00000127528
Protein
UniProt ID Q9Y5W3
Protein name Krueppel-like factor 2 (Lung krueppel-like factor)
Protein function Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription (PubMed:21063504). Might be involved in transcriptional regulation by modulating the binding of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 272 296 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 302 326 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 332 354 Zinc finger, C2H2 type Domain
Sequence
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  FoxO signaling pathway
Apelin signaling pathway
Fluid shear stress and atherosclerosis
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
30510241
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
30510241
Multiple myeloma Multiple Myeloma rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962
View all (38 more)
30213928
Unknown
Disease term Disease name Evidence References Source
Pulmonary arterial hypertension pulmonary arterial hypertension GenCC
Coronary artery disease Coronary artery disease GWAS
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Inhibit 24107715
Adenomatous Polyposis Coli Associate 38073344
Atherosclerosis Associate 17244683, 26372274, 30881601
Autoimmune Diseases Associate 36466816
Breast Neoplasms Associate 20132413, 31378902, 36100919, 39796183
Carcinogenesis Associate 37147883
Carcinoma Hepatocellular Associate 26336870, 34564989, 36177006, 37386390
Carcinoma Hepatocellular Inhibit 32318691
Carcinoma Non Small Cell Lung Inhibit 25501704
Carcinoma Non Small Cell Lung Associate 35587058