Gene Gene information from NCBI Gene database.
Entrez ID 10361
Gene name Nucleophosmin/nucleoplasmin 2
Gene symbol NPM2
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p21.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 12714744
GO:0001824 Process Blastocyst development IMP 12714744
GO:0003682 Function Chromatin binding IBA
GO:0003682 Function Chromatin binding IEA
GO:0003723 Function RNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608073 7930 ENSG00000158806
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86SE8
Protein name Nucleoplasmin-2
Protein function Core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. Probably involved in sperm DNA decondensation during fertilization.
PDB 3T30
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03066 Nucleoplasmin 18 121 Nucleoplasmin/nucleophosmin domain Domain
Sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMH
RVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQER
Y
EASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKK
LEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Sequence length 214
Interactions View interactions