Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1036
Gene name Gene Name - the full gene name approved by the HGNC.	Cysteine dioxygenase type 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDO1
Synonyms (NCBI Gene) Gene synonyms aliases	CDO-I
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q22.3

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022885	hsa-miR-124-3p	Microarray	18668037
MIRT1961267	hsa-miR-1238	CLIP-seq
MIRT2198008	hsa-miR-548c-3p	CLIP-seq
MIRT2198009	hsa-miR-570	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYB	Activation	18033314

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000097	Process	Sulfur amino acid biosynthetic process	TAS	12110289
GO:0005506	Function	Iron ion binding	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	12110289
GO:0006534	Process	Cysteine metabolic process	IEA
GO:0006534	Process	Cysteine metabolic process	TAS	12110289
GO:0006954	Process	Inflammatory response	TAS	12110289
GO:0007595	Process	Lactation	IEA
GO:0008198	Function	Ferrous iron binding	IBA
GO:0008198	Function	Ferrous iron binding	IDA	17135237
GO:0008198	Function	Ferrous iron binding	IEA
GO:0008270	Function	Zinc ion binding	IDA	17135237
GO:0008270	Function	Zinc ion binding	IEA
GO:0016151	Function	Nickel cation binding	IEA
GO:0016151	Function	Nickel cation binding	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0017172	Function	Cysteine dioxygenase activity	IBA
GO:0017172	Function	Cysteine dioxygenase activity	IDA	17135237
GO:0017172	Function	Cysteine dioxygenase activity	IEA
GO:0017172	Function	Cysteine dioxygenase activity	ISS
GO:0019448	Process	L-cysteine catabolic process	IBA
GO:0019448	Process	L-cysteine catabolic process	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0042412	Process	Taurine biosynthetic process	IEA
GO:0042412	Process	Taurine biosynthetic process	TAS	12871209
GO:0043200	Process	Response to amino acid	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0097184	Process	Response to azide	IEA

MIM	HGNC	e!Ensembl
603943	1795	ENSG00000129596

Protein

UniProt ID

Q16878

Protein name

Cysteine dioxygenase type 1 (EC 1.13.11.20) (Cysteine dioxygenase type I) (CDO) (CDO-I)

Protein function

Catalyzes the oxidation of cysteine to cysteine sulfinic acid with addition of molecular dioxygen.

PDB

2IC1 , 6BGF , 6BGM , 6BPR , 6BPS , 6BPT , 6BPU , 6BPV , 6BPW , 6BPX , 6CDH , 6CDN , 6E87 , 6N42 , 6N43 , 8VL9 , 8VLB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05995	CDO_I	1 → 170	Cysteine dioxygenase type I	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells. {ECO:0000269|PubMed:10427686}.

Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKK
SERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMT
FHSKFGIRTPNATSGSLENN

Sequence length

200

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Taurine and hypotaurine metabolism Metabolic pathways		Degradation of cysteine and homocysteine

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neurodevelopmental Disorders	neurodevelopmental disorder	N/A	N/A	GenCC

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	29746493
Adenoma	Associate	29746493
Biliary Tract Neoplasms	Associate	30325974
Breast Neoplasms	Associate	20515469, 22647880, 23630167, 25904753, 26785325, 37740473
Carcinogenesis	Associate	24646840
Carcinoma Hepatocellular	Associate	24646840, 34255396, 38308276, 39516467
Carcinoma Non Small Cell Lung	Associate	32430478, 35793574, 36461127
Carcinoma Pancreatic Ductal	Associate	31956659
Carcinoma Renal Cell	Associate	25904753
Carcinoma Squamous Cell	Associate	22011669
Cholangiocarcinoma	Associate	22983262, 24948044, 25644509, 30325974
Colorectal Neoplasms	Associate	24948044, 25469504, 29746493
Diabetes Mellitus	Associate	36206624
Endometrial Neoplasms	Associate	31779688, 32170852
Esophageal Squamous Cell Carcinoma	Associate	25903467
Gallbladder Neoplasms	Associate	29161283
Gastrointestinal Neoplasms	Associate	24948044
Gastrointestinal Stromal Tumors	Associate	30677088
Inflammation	Inhibit	36206624
Leiomyosarcoma	Associate	30677088
Lung Neoplasms	Associate	26842235, 32138766, 34620221, 38225788
Lymphoma	Associate	30677088
Multiple Pulmonary Nodules	Associate	34620221
Neoplasm Metastasis	Associate	20515469, 29746493, 30934021
Neoplasm Residual	Associate	33576114
Neoplasms	Associate	22983262, 26785325, 27729459, 29161283, 29746493, 30677088, 30934021, 32138766, 32430478, 33576114, 37406020
Neoplasms	Inhibit	24646840, 25538261, 25903467, 34255396, 37740473, 38308276
Oculocutaneous albinism type 2	Associate	30677088
Ovarian Neoplasms	Associate	35370009
Precancerous Conditions	Associate	29746493
Prodromal Symptoms	Associate	30934021
Prostatic Neoplasms	Associate	27689475
Stomach Neoplasms	Associate	30702489, 30934021, 33576114
Tarlov Cysts	Associate	30325974
Tertiary Lymphoid Structures	Associate	20515469
Triple Negative Breast Neoplasms	Associate	40179432
Xanthogranulomatous cholecystitis	Associate	29161283

CDO1 (cysteine dioxygenase type 1)