Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10346
Gene name	Tripartite motif containing 22
Gene symbol	TRIM22
Synonyms (NCBI Gene)	GPSTAF50RNF94STAF50
Chromosome	11
Chromosome location	11p15.4
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its ex

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018054	hsa-miR-335-5p	Microarray	18185580
MIRT021245	hsa-miR-146a-5p	Microarray	18057241
MIRT029579	hsa-miR-26b-5p	Microarray	19088304
MIRT1453254	hsa-miR-106a	CLIP-seq
MIRT1453255	hsa-miR-106b	CLIP-seq
MIRT1453256	hsa-miR-17	CLIP-seq
MIRT1453257	hsa-miR-20a	CLIP-seq
MIRT1453258	hsa-miR-20b	CLIP-seq
MIRT1453259	hsa-miR-376a	CLIP-seq
MIRT1453260	hsa-miR-376b	CLIP-seq
MIRT1453261	hsa-miR-4282	CLIP-seq
MIRT1453262	hsa-miR-4760-3p	CLIP-seq
MIRT1453263	hsa-miR-515-3p	CLIP-seq
MIRT1453264	hsa-miR-519d	CLIP-seq
MIRT1453265	hsa-miR-519e	CLIP-seq
MIRT1453266	hsa-miR-548t	CLIP-seq
MIRT1453267	hsa-miR-93	CLIP-seq
MIRT1453268	hsa-miR-127-5p	CLIP-seq
MIRT1453269	hsa-miR-548p	CLIP-seq
MIRT1453270	hsa-miR-570	CLIP-seq
MIRT2135798	hsa-miR-4321	CLIP-seq
MIRT2650344	hsa-miR-1224-5p	CLIP-seq
MIRT2650345	hsa-miR-1245	CLIP-seq
MIRT2650346	hsa-miR-1304	CLIP-seq
MIRT2650347	hsa-miR-190	CLIP-seq
MIRT2650348	hsa-miR-190b	CLIP-seq
MIRT2650349	hsa-miR-200b	CLIP-seq
MIRT2650350	hsa-miR-200c	CLIP-seq
MIRT2650351	hsa-miR-2116	CLIP-seq
MIRT2650352	hsa-miR-2467-3p	CLIP-seq
MIRT2650353	hsa-miR-3120-3p	CLIP-seq
MIRT2650354	hsa-miR-3121-5p	CLIP-seq
MIRT2650355	hsa-miR-3125	CLIP-seq
MIRT2650356	hsa-miR-3159	CLIP-seq
MIRT2650357	hsa-miR-3163	CLIP-seq
MIRT2650358	hsa-miR-3591-3p	CLIP-seq
MIRT2650359	hsa-miR-3609	CLIP-seq
MIRT2650360	hsa-miR-371-5p	CLIP-seq
MIRT2650361	hsa-miR-371b-5p	CLIP-seq
MIRT2650362	hsa-miR-383	CLIP-seq
MIRT2650363	hsa-miR-3915	CLIP-seq
MIRT2650364	hsa-miR-3916	CLIP-seq
MIRT2650365	hsa-miR-3928	CLIP-seq
MIRT2650366	hsa-miR-3936	CLIP-seq
MIRT2650367	hsa-miR-3942-5p	CLIP-seq
MIRT2650368	hsa-miR-3973	CLIP-seq
MIRT2650369	hsa-miR-4257	CLIP-seq
MIRT2650370	hsa-miR-429	CLIP-seq
MIRT2650371	hsa-miR-4307	CLIP-seq
MIRT2650372	hsa-miR-4476	CLIP-seq
MIRT2650373	hsa-miR-4477b	CLIP-seq
MIRT2650374	hsa-miR-4496	CLIP-seq
MIRT2650375	hsa-miR-450b-5p	CLIP-seq
MIRT2650376	hsa-miR-452	CLIP-seq
MIRT2650377	hsa-miR-4533	CLIP-seq
MIRT2650378	hsa-miR-4635	CLIP-seq
MIRT2650379	hsa-miR-4659a-3p	CLIP-seq
MIRT2650380	hsa-miR-4659b-3p	CLIP-seq
MIRT2650381	hsa-miR-4676-3p	CLIP-seq
MIRT2650382	hsa-miR-4677-5p	CLIP-seq
MIRT2650383	hsa-miR-4678	CLIP-seq
MIRT2650384	hsa-miR-4688	CLIP-seq
MIRT2650385	hsa-miR-4689	CLIP-seq
MIRT2650386	hsa-miR-4696	CLIP-seq
MIRT2650387	hsa-miR-4703-5p	CLIP-seq
MIRT2650388	hsa-miR-4753-3p	CLIP-seq
MIRT2650389	hsa-miR-4768-5p	CLIP-seq
MIRT2650390	hsa-miR-4772-5p	CLIP-seq
MIRT2650391	hsa-miR-4775	CLIP-seq
MIRT2650392	hsa-miR-486-3p	CLIP-seq
MIRT2650393	hsa-miR-513c	CLIP-seq
MIRT2650394	hsa-miR-514b-5p	CLIP-seq
MIRT2650395	hsa-miR-518a-5p	CLIP-seq
MIRT2650396	hsa-miR-520g	CLIP-seq
MIRT2650397	hsa-miR-520h	CLIP-seq
MIRT2650398	hsa-miR-527	CLIP-seq
MIRT2650399	hsa-miR-548ah	CLIP-seq
MIRT2650400	hsa-miR-548n	CLIP-seq
MIRT1453266	hsa-miR-548t	CLIP-seq
MIRT2650401	hsa-miR-555	CLIP-seq
MIRT2650402	hsa-miR-561	CLIP-seq
MIRT2650347	hsa-miR-190	CLIP-seq
MIRT2650348	hsa-miR-190b	CLIP-seq
MIRT2650349	hsa-miR-200b	CLIP-seq
MIRT2650350	hsa-miR-200c	CLIP-seq
MIRT2650351	hsa-miR-2116	CLIP-seq
MIRT2650352	hsa-miR-2467-3p	CLIP-seq
MIRT2650353	hsa-miR-3120-3p	CLIP-seq
MIRT2650354	hsa-miR-3121-5p	CLIP-seq
MIRT2650355	hsa-miR-3125	CLIP-seq
MIRT2650356	hsa-miR-3159	CLIP-seq
MIRT2650357	hsa-miR-3163	CLIP-seq
MIRT2694119	hsa-miR-338-5p	CLIP-seq
MIRT2694120	hsa-miR-3913-3p	CLIP-seq
MIRT2650363	hsa-miR-3915	CLIP-seq
MIRT2650364	hsa-miR-3916	CLIP-seq
MIRT2650365	hsa-miR-3928	CLIP-seq
MIRT2650366	hsa-miR-3936	CLIP-seq
MIRT2650367	hsa-miR-3942-5p	CLIP-seq
MIRT2650370	hsa-miR-429	CLIP-seq
MIRT2650371	hsa-miR-4307	CLIP-seq
MIRT2650372	hsa-miR-4476	CLIP-seq
MIRT2650373	hsa-miR-4477b	CLIP-seq
MIRT2650374	hsa-miR-4496	CLIP-seq
MIRT2650375	hsa-miR-450b-5p	CLIP-seq
MIRT2650376	hsa-miR-452	CLIP-seq
MIRT2650377	hsa-miR-4533	CLIP-seq
MIRT2650379	hsa-miR-4659a-3p	CLIP-seq
MIRT2650380	hsa-miR-4659b-3p	CLIP-seq
MIRT2650381	hsa-miR-4676-3p	CLIP-seq
MIRT2650382	hsa-miR-4677-5p	CLIP-seq
MIRT2650383	hsa-miR-4678	CLIP-seq
MIRT2650384	hsa-miR-4688	CLIP-seq
MIRT2650386	hsa-miR-4696	CLIP-seq
MIRT2650387	hsa-miR-4703-5p	CLIP-seq
MIRT2650388	hsa-miR-4753-3p	CLIP-seq
MIRT2650389	hsa-miR-4768-5p	CLIP-seq
MIRT2650392	hsa-miR-486-3p	CLIP-seq
MIRT2694121	hsa-miR-489	CLIP-seq
MIRT2650395	hsa-miR-518a-5p	CLIP-seq
MIRT2650398	hsa-miR-527	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
CREBBP	Unknown	23670564
EP300	Activation	23670564
IRF1	Unknown	21683060;23670564;23729439
TP53	Activation	15064739

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	36159777
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0003714	Function	Transcription corepressor activity	TAS	7797467
GO:0005515	Function	Protein binding	IPI	25127057, 26836588, 32296183
GO:0005634	Component	Nucleus	IDA	17156811
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7797467
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17156811
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	7797467
GO:0006955	Process	Immune response	TAS	7797467
GO:0008270	Function	Zinc ion binding	IEA
GO:0009615	Process	Response to virus	TAS	7797467
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010508	Process	Positive regulation of autophagy	IBA
GO:0010508	Process	Positive regulation of autophagy	IMP	26347139
GO:0015030	Component	Cajal body	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	25127057
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IMP	25127057
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	17156811
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	23077300
GO:0045087	Process	Innate immune response	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	36159777
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	36159777
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	27992402, 28469175

MIM	HGNC	e!Ensembl
606559	16379	ENSG00000132274

Q8IYM9

Protein name

E3 ubiquitin-protein ligase TRIM22 (EC 2.3.2.27) (50 kDa-stimulated trans-acting factor) (RING finger protein 94) (RING-type E3 ubiquitin transferase TRIM22) (Staf-50) (Tripartite motif-containing protein 22)

Protein function

Interferon-induced E3 ubiquitin ligase that plays important roles in innate and adaptive immunity (PubMed:25683609, PubMed:35777501). Restricts the replication of many viruses including HIV-1, encephalomyocarditis virus (EMCV), hepatitis B virus

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	15 → 59		Domain
PF00643	zf-B_box	92 → 133	B-box zinc finger	Domain
PF00622	SPRY	354 → 494	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in peripheral blood leukocytes, spleen, thymus, and ovary. Expressed at basal levels in other tissues. {ECO:0000269|PubMed:7797467}.

Sequence

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQ
TRFQPGNLRPNRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCE
LSQEHQGHQTFRINEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIER
QKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRR
LRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW
VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYFSSGKYYWEVD
VSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYP
YFNPWNCLVPMTVCPPSS

Sequence length

498

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INFLAMMATORY BOWEL DISEASE	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIM22-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Psoriatic	Stimulate	25809693	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	35946462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	24983760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	32319602	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	37014321, 38199981	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	26599082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	32296577	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Associate	34558381	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	33299853	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35023286, 36028902, 36621405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Associate	35609018	★★★★★ ★☆☆☆☆ Found in Text Mining only
DNA Virus Infections	Associate	33524065	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Inhibit	32319602	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	37258577	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	18004563	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	27590274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heroin Dependence	Associate	28104465	★★★★★ ★☆☆☆☆ Found in Text Mining only
Herpes Simplex	Associate	34552595	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	20980524, 24367701, 24478420, 34870928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	32319602, 35946462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	27590274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	27590274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	23623029	★★★★★ ★☆☆☆☆ Found in Text Mining only
Measles	Associate	27590274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	35135212	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Inhibit	37415153	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Stimulate	24066097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	24983760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Diseases	Associate	35609018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal herpes	Associate	33524065	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24983760, 35946462, 37415153, 38199981	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	32296577, 32319602	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Associate	35609018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rubella	Associate	27590274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Stimulate	39331939	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	40680432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	27590274, 36621405	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM22 (tripartite motif containing 22)