Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10342
Gene name Gene Name - the full gene name approved by the HGNC.
Trafficking from ER to golgi regulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFG
Synonyms (NCBI Gene) Gene synonyms aliases
HMSNP, SPG57, TF6, TRKT3
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Mult
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs111356679 C>G Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs207482230 C>T Pathogenic Coding sequence variant, missense variant
rs587777175 C>T Pathogenic Missense variant, coding sequence variant
rs587777789 G>A,T Pathogenic Missense variant, coding sequence variant
rs764959531 C>A,T Likely-pathogenic Coding sequence variant, synonymous variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004131 hsa-miR-192-5p Microarray 16822819
MIRT049807 hsa-miR-92a-3p CLASH 23622248
MIRT048315 hsa-miR-106a-5p CLASH 23622248
MIRT041287 hsa-miR-193b-3p CLASH 23622248
MIRT036854 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 17110338, 21478858, 25416956, 25910212, 26871637, 27813252, 31515488, 32296183, 32814053, 35156780, 36012204
GO:0005737 Component Cytoplasm NAS 7565764
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602498 11758 ENSG00000114354
Protein
UniProt ID Q92734
Protein name Protein TFG (TRK-fused gene protein)
Protein function Plays a role in the normal dynamic function of the endoplasmic reticulum (ER) and its associated microtubules (PubMed:23479643, PubMed:27813252). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus (PubMed:
PDB 8TEQ , 8TER , 9E7C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00564 PB1 10 93 PB1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQ
PRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
Sequence length 400
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Pathways in cancer
Thyroid cancer
  COPII-mediated vesicle transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary Motor And Sensory Neuropathy hereditary motor and sensory neuropathy, okinawa type rs207482230, rs587777789 N/A
Hereditary spastic paraplegia Hereditary spastic paraplegia 57 rs587777175, rs587777789 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis 2 Juvenile Associate 27601211
Carcinogenesis Associate 31754244, 32239802
Carcinoma Hepatocellular Associate 29180379
Carcinoma Pancreatic Ductal Associate 32239802
Carcinoma Papillary Follicular Associate 25148236
Charcot Marie Tooth disease X linked recessive 2 Associate 32666699
Cholangiocarcinoma Associate 31754244
Cushing Syndrome Associate 36690805
Dysgerminoma Stimulate 21793190
Fasciculation Associate 30157421