Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10333
Gene name	Toll like receptor 6
Gene symbol	TLR6
Synonyms (NCBI Gene)	CD286
Chromosome	4
Chromosome location	4p14
Summary	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

199

Show/Hide all (199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT679765	hsa-miR-1245a	HITS-CLIP	23824327
MIRT679764	hsa-miR-8079	HITS-CLIP	23824327
MIRT679763	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT679762	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679761	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT679760	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT679759	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT679758	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT679757	hsa-miR-6131	HITS-CLIP	23824327
MIRT679756	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT679755	hsa-miR-640	HITS-CLIP	23824327
MIRT679754	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT679753	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT652575	hsa-miR-7153-3p	HITS-CLIP	23824327
MIRT652574	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT652573	hsa-miR-95-5p	HITS-CLIP	23824327
MIRT652572	hsa-miR-3185	HITS-CLIP	23824327
MIRT652571	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT652570	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT652569	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT652568	hsa-miR-23c	HITS-CLIP	23824327
MIRT652567	hsa-miR-3611	HITS-CLIP	23824327
MIRT652565	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT679765	hsa-miR-1245a	HITS-CLIP	23824327
MIRT679764	hsa-miR-8079	HITS-CLIP	23824327
MIRT679763	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT679762	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679761	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT679760	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT679759	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT679758	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT679757	hsa-miR-6131	HITS-CLIP	23824327
MIRT679756	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT679755	hsa-miR-640	HITS-CLIP	23824327
MIRT679754	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT679753	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT652575	hsa-miR-7153-3p	HITS-CLIP	23824327
MIRT652574	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT652573	hsa-miR-95-5p	HITS-CLIP	23824327
MIRT652572	hsa-miR-3185	HITS-CLIP	23824327
MIRT652571	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT652570	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT652569	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT652568	hsa-miR-23c	HITS-CLIP	23824327
MIRT652567	hsa-miR-3611	HITS-CLIP	23824327
MIRT652565	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT1426977	hsa-miR-1245	CLIP-seq
MIRT1426978	hsa-miR-1262	CLIP-seq
MIRT1426979	hsa-miR-1278	CLIP-seq
MIRT1426980	hsa-miR-1280	CLIP-seq
MIRT1426981	hsa-miR-1294	CLIP-seq
MIRT1426982	hsa-miR-1324	CLIP-seq
MIRT1426983	hsa-miR-149	CLIP-seq
MIRT1426984	hsa-miR-15a	CLIP-seq
MIRT1426985	hsa-miR-15b	CLIP-seq
MIRT1426986	hsa-miR-16	CLIP-seq
MIRT1426987	hsa-miR-195	CLIP-seq
MIRT1426988	hsa-miR-197	CLIP-seq
MIRT1426989	hsa-miR-3064-5p	CLIP-seq
MIRT1426990	hsa-miR-3065-3p	CLIP-seq
MIRT1426991	hsa-miR-3126-3p	CLIP-seq
MIRT1426992	hsa-miR-3169	CLIP-seq
MIRT1426993	hsa-miR-3187-3p	CLIP-seq
MIRT1426994	hsa-miR-3907	CLIP-seq
MIRT1426995	hsa-miR-3914	CLIP-seq
MIRT1426996	hsa-miR-3915	CLIP-seq
MIRT1426997	hsa-miR-3928	CLIP-seq
MIRT1426998	hsa-miR-424	CLIP-seq
MIRT1426999	hsa-miR-4316	CLIP-seq
MIRT1427000	hsa-miR-4435	CLIP-seq
MIRT1427001	hsa-miR-4677-3p	CLIP-seq
MIRT1427002	hsa-miR-4701-3p	CLIP-seq
MIRT1427003	hsa-miR-4701-5p	CLIP-seq
MIRT1427004	hsa-miR-4716-5p	CLIP-seq
MIRT1427005	hsa-miR-4781-3p	CLIP-seq
MIRT1427006	hsa-miR-4794	CLIP-seq
MIRT1427007	hsa-miR-497	CLIP-seq
MIRT1427008	hsa-miR-5096	CLIP-seq
MIRT1427009	hsa-miR-548s	CLIP-seq
MIRT1427010	hsa-miR-576-3p	CLIP-seq
MIRT1427011	hsa-miR-588	CLIP-seq
MIRT1427012	hsa-miR-765	CLIP-seq
MIRT1426977	hsa-miR-1245	CLIP-seq
MIRT1426977	hsa-miR-1245	CLIP-seq
MIRT1426988	hsa-miR-197	CLIP-seq
MIRT1426993	hsa-miR-3187-3p	CLIP-seq
MIRT1427000	hsa-miR-4435	CLIP-seq
MIRT1427003	hsa-miR-4701-5p	CLIP-seq
MIRT1427004	hsa-miR-4716-5p	CLIP-seq
MIRT1427005	hsa-miR-4781-3p	CLIP-seq
MIRT1427008	hsa-miR-5096	CLIP-seq
MIRT1427009	hsa-miR-548s	CLIP-seq
MIRT1427011	hsa-miR-588	CLIP-seq
MIRT2127909	hsa-miR-1207-5p	CLIP-seq
MIRT1426977	hsa-miR-1245	CLIP-seq
MIRT2127910	hsa-miR-1322	CLIP-seq
MIRT2127911	hsa-miR-1827	CLIP-seq
MIRT1426988	hsa-miR-197	CLIP-seq
MIRT2127912	hsa-miR-198	CLIP-seq
MIRT2127913	hsa-miR-3065-5p	CLIP-seq
MIRT2127914	hsa-miR-3074-5p	CLIP-seq
MIRT2127915	hsa-miR-3158-3p	CLIP-seq
MIRT2127916	hsa-miR-3175	CLIP-seq
MIRT2127917	hsa-miR-3199	CLIP-seq
MIRT2127918	hsa-miR-4515	CLIP-seq
MIRT1427004	hsa-miR-4716-5p	CLIP-seq
MIRT2127919	hsa-miR-4721	CLIP-seq
MIRT2127920	hsa-miR-4722-3p	CLIP-seq
MIRT2127921	hsa-miR-4735-5p	CLIP-seq
MIRT2127922	hsa-miR-4740-3p	CLIP-seq
MIRT2127923	hsa-miR-4763-3p	CLIP-seq
MIRT2127924	hsa-miR-4775	CLIP-seq
MIRT1427005	hsa-miR-4781-3p	CLIP-seq
MIRT1427008	hsa-miR-5096	CLIP-seq
MIRT2127925	hsa-miR-552	CLIP-seq
MIRT2127926	hsa-miR-590-3p	CLIP-seq
MIRT2127927	hsa-miR-764	CLIP-seq
MIRT2127928	hsa-miR-940	CLIP-seq
MIRT2127909	hsa-miR-1207-5p	CLIP-seq
MIRT1426977	hsa-miR-1245	CLIP-seq
MIRT1426982	hsa-miR-1324	CLIP-seq
MIRT2127911	hsa-miR-1827	CLIP-seq
MIRT2127914	hsa-miR-3074-5p	CLIP-seq
MIRT2349556	hsa-miR-3150a-3p	CLIP-seq
MIRT2127916	hsa-miR-3175	CLIP-seq
MIRT2127917	hsa-miR-3199	CLIP-seq
MIRT2349557	hsa-miR-3943	CLIP-seq
MIRT2349558	hsa-miR-4323	CLIP-seq
MIRT2349559	hsa-miR-4632	CLIP-seq
MIRT2349560	hsa-miR-4667-5p	CLIP-seq
MIRT2349561	hsa-miR-4700-5p	CLIP-seq
MIRT2127920	hsa-miR-4722-3p	CLIP-seq
MIRT2127921	hsa-miR-4735-5p	CLIP-seq
MIRT2127922	hsa-miR-4740-3p	CLIP-seq
MIRT2127923	hsa-miR-4763-3p	CLIP-seq
MIRT2127924	hsa-miR-4775	CLIP-seq
MIRT2349562	hsa-miR-532-3p	CLIP-seq
MIRT2127925	hsa-miR-552	CLIP-seq
MIRT2127926	hsa-miR-590-3p	CLIP-seq
MIRT2349563	hsa-miR-593	CLIP-seq
MIRT2127927	hsa-miR-764	CLIP-seq
MIRT2349564	hsa-miR-939	CLIP-seq
MIRT2127928	hsa-miR-940	CLIP-seq
MIRT2349565	hsa-miR-941	CLIP-seq
MIRT2395862	hsa-miR-1267	CLIP-seq
MIRT2395863	hsa-miR-2355-5p	CLIP-seq
MIRT2395864	hsa-miR-4279	CLIP-seq
MIRT2395865	hsa-miR-4652-3p	CLIP-seq
MIRT2461510	hsa-miR-1253	CLIP-seq
MIRT2461511	hsa-miR-185	CLIP-seq
MIRT2461512	hsa-miR-3150b-3p	CLIP-seq
MIRT2127917	hsa-miR-3199	CLIP-seq
MIRT2461513	hsa-miR-4306	CLIP-seq
MIRT2461514	hsa-miR-4644	CLIP-seq
MIRT2461515	hsa-miR-4784	CLIP-seq
MIRT2127925	hsa-miR-552	CLIP-seq
MIRT2127927	hsa-miR-764	CLIP-seq
MIRT2349565	hsa-miR-941	CLIP-seq
MIRT2643084	hsa-miR-1297	CLIP-seq
MIRT2643085	hsa-miR-150	CLIP-seq
MIRT2643086	hsa-miR-1915	CLIP-seq
MIRT2643087	hsa-miR-26a	CLIP-seq
MIRT2643088	hsa-miR-26b	CLIP-seq
MIRT2643089	hsa-miR-3120-5p	CLIP-seq
MIRT2643090	hsa-miR-3149	CLIP-seq
MIRT2643091	hsa-miR-4465	CLIP-seq
MIRT2643092	hsa-miR-4713-5p	CLIP-seq
MIRT2643093	hsa-miR-4726-3p	CLIP-seq
MIRT2127921	hsa-miR-4735-5p	CLIP-seq
MIRT2127924	hsa-miR-4775	CLIP-seq
MIRT2349562	hsa-miR-532-3p	CLIP-seq
MIRT2127926	hsa-miR-590-3p	CLIP-seq
MIRT2349565	hsa-miR-941	CLIP-seq
MIRT2643084	hsa-miR-1297	CLIP-seq
MIRT2643085	hsa-miR-150	CLIP-seq
MIRT2643086	hsa-miR-1915	CLIP-seq
MIRT2643087	hsa-miR-26a	CLIP-seq
MIRT2643088	hsa-miR-26b	CLIP-seq
MIRT2643089	hsa-miR-3120-5p	CLIP-seq
MIRT2693223	hsa-miR-3122	CLIP-seq
MIRT2643090	hsa-miR-3149	CLIP-seq
MIRT2693224	hsa-miR-3190	CLIP-seq
MIRT2127917	hsa-miR-3199	CLIP-seq
MIRT2693225	hsa-miR-3913-5p	CLIP-seq
MIRT2643091	hsa-miR-4465	CLIP-seq
MIRT2693226	hsa-miR-450b-3p	CLIP-seq
MIRT2693227	hsa-miR-455-5p	CLIP-seq
MIRT2643092	hsa-miR-4713-5p	CLIP-seq
MIRT2643093	hsa-miR-4726-3p	CLIP-seq
MIRT2127921	hsa-miR-4735-5p	CLIP-seq
MIRT2693228	hsa-miR-4752	CLIP-seq
MIRT2127924	hsa-miR-4775	CLIP-seq
MIRT2349562	hsa-miR-532-3p	CLIP-seq
MIRT2127925	hsa-miR-552	CLIP-seq
MIRT2127926	hsa-miR-590-3p	CLIP-seq
MIRT2693229	hsa-miR-7	CLIP-seq
MIRT2127927	hsa-miR-764	CLIP-seq
MIRT2693230	hsa-miR-769-3p	CLIP-seq
MIRT2349565	hsa-miR-941	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HIF1A	Unknown	18159247

Show/Hide all (88)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001774	Process	Microglial cell activation	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IDA	20037584
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	20037584
GO:0005515	Function	Protein binding	IPI	16880211, 20037584, 20067962, 23155421, 33961781
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	33576548
GO:0005886	Component	Plasma membrane	TAS	10231569
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10426995
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10231569
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	NAS	10231569
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032493	Process	Response to bacterial lipoprotein	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	IGI	22198949
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS	12077222
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	IGI	22198949
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IBA
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IDA	16880211
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IEA
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IPI	23155421
GO:0035663	Function	Toll-like receptor 2 binding	IBA
GO:0035663	Function	Toll-like receptor 2 binding	IPI	16880211
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	ISS
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	TAS	10426995
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	23626692
GO:0042496	Process	Detection of diacyl bacterial lipopeptide	IDA	19931471
GO:0042498	Function	Diacyl lipopeptide binding	IEA
GO:0042742	Process	Defense response to bacterium	TAS	10426995
GO:0042802	Function	Identical protein binding	IDA	25088687
GO:0042802	Function	Identical protein binding	IPI	23155421
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10231569
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	20037584
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	10231569
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	33576548
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045121	Component	Membrane raft	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0046209	Process	Nitric oxide metabolic process	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20037584
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0071723	Function	Lipopeptide binding	IBA
GO:0071723	Function	Lipopeptide binding	IEA
GO:0071723	Function	Lipopeptide binding	ISS	11431423
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IBA
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	19931471
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IDA	20037584
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IDA	20037584
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
605403	16711	ENSG00000174130

Q9Y2C9

Protein name

Toll-like receptor 6 (CD antigen CD286)

Protein function

Participates in the innate immune response to Gram-positive bacteria and fungi. Specifically recognizes diacylated and, to a lesser extent, triacylated lipopeptides (PubMed:20037584). In response to diacylated lipopeptides, forms the activation

PDB

4OM7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	76 → 133	Leucine rich repeat	Repeat
PF13855	LRR_8	450 → 507	Leucine rich repeat	Repeat
PF01463	LRRCT	558 → 583	Leucine rich repeat C-terminal domain	Family
PF01582	TIR	641 → 796	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in monocytes, CD11c+ immature dendritic cells, plasmacytoid pre-dendritic cells and dermal microvessel endothelial cells.

Sequence

MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS

Sequence length

796

Interactions

View interactions

	KEGG		Reactome
	Phagosome Toll-like receptor signaling pathway Salmonella infection Chagas disease Tuberculosis Lipid and atherosclerosis		ER-Phagosome pathway MyD88:MAL(TIRAP) cascade initiated on plasma membrane Toll Like Receptor TLR6:TLR2 Cascade MyD88 deficiency (TLR2/4) IRAK4 deficiency (TLR2/4) Regulation of TLR by endogenous ligand

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormality of neuronal migration	Benign	rs863223364	RCV000201386
Cervical cancer	not provided	rs137853183	RCV005887817
Leprosy, susceptibility to, 1	protective	rs5743810	RCV002291822
Multisystem inflammatory syndrome in children	risk factor	rs753476926	RCV001779424
Susceptibility to severe COVID-19	Likely risk allele	rs776294736	RCV003120374

Show/Hide Text Mining Associations (85)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abscess	Associate	31786695
Adenocarcinoma	Associate	27008696
Adenocarcinoma of Lung	Stimulate	37746997
Adenocarcinoma of Lung	Associate	38204755
Arthritis Infectious	Associate	20740673
Arthritis Rheumatoid	Associate	31376255
Asthma	Associate	16188043, 20815312, 28262750, 33066754
Astrocytoma	Associate	29912993
Autism Spectrum Disorder	Associate	22226452
Autoimmune Diseases	Associate	29339359
Behcet Syndrome	Associate	32756992, 36226612
Brachydactyly Type D	Associate	28504607
Breast Neoplasms	Associate	30388713, 31789409
Bronchopulmonary Dysplasia	Inhibit	23518821
Bronchopulmonary Dysplasia	Associate	23518821
Chondrosarcoma	Inhibit	29138803
Colitis Ulcerative	Associate	22185629, 32322884
COVID 19	Stimulate	36651678
Death	Associate	36071076
Dermatitis Atopic	Associate	26682905
Diabetes Mellitus	Associate	32573975
Diabetes Mellitus Type 1	Associate	25261617
Diabetic Foot	Associate	31786695, 32573975
Disorders of Excessive Somnolence	Associate	32069296
Ehlers Danlos syndrome type 6	Associate	32853438
Endometritis	Associate	23255565
Esophageal Neoplasms	Associate	37232814
Esophageal Squamous Cell Carcinoma	Associate	37232814
Fatty Liver Alcoholic	Associate	27834919
Gastrointestinal Diseases	Associate	35639375
Glioblastoma	Associate	31282108
Graves Disease	Associate	25028161
Hereditary Angioedema Type III	Associate	29339359
HIV Infections	Associate	30147152
Infections	Associate	21957307, 25347003
Inflammation	Associate	17645528, 20959532, 21952587, 23593431, 25376541, 25965265, 27834919, 29127590, 30131804, 35682575, 36226612
Inflammation	Stimulate	32853438
Inflammatory Bowel Diseases	Associate	17595233
Intervertebral Disc Degeneration	Associate	24997157
Laryngeal Neoplasms	Associate	21478107
Legionnaires' Disease	Associate	23823019
Leishmaniasis Diffuse Cutaneous	Inhibit	25397678
Leprosy	Associate	31781675
Leukemia Lymphocytic Chronic B Cell	Associate	21750087
Leukemia Prolymphocytic T Cell	Associate	19036098
Lichenoid Eruptions	Associate	28715461
Liver Failure	Associate	27834919
Lupus Erythematosus Systemic	Associate	19843090
Lupus Vasculitis Central Nervous System	Stimulate	40011954
Lymphoma B Cell Marginal Zone	Associate	26294727
Lymphoma Non Hodgkin	Associate	17827388, 19029192
Melanoma	Associate	25765738
Meningioma	Associate	20406964
Mitral Valve Insufficiency	Associate	27589735
Mucocutaneous Lymph Node Syndrome	Associate	28061462, 28151979
Myelodysplastic Syndromes	Associate	23765228, 35367529
Neoplasm Metastasis	Associate	30203045
Neoplasms	Associate	23424670, 35937402, 38204755
Neoplasms	Inhibit	29138803
Neurosyphilis	Associate	24922103
Non alcoholic Fatty Liver Disease	Stimulate	27834919
Obesity	Associate	27834919
Otitis	Inhibit	24434259
Ovarian Neoplasms	Stimulate	25376541
Pancreatic Neoplasms	Associate	25945796
pediatric multisystem inflammatory disease COVID 19 related	Associate	35639375
Pediatric Obesity	Associate	23518821
Pelvic Inflammatory Disease	Associate	23255565
Polysaccharide Storage of Unusual	Associate	22226452
Prostatic Neoplasms	Associate	23272139, 23657238
Pulmonary Disease Chronic Obstructive	Associate	23374856
Reproductive Tract Infections	Associate	23255565
Respiratory Tract Infections	Associate	30131804
Retinal Dysplasia	Associate	27008696
Rhinitis Allergic	Associate	20815312, 28228119
Skin Diseases	Associate	31786695
Sleep Apnea Obstructive	Associate	32069296
Synovitis	Associate	33377396
Systemic Inflammatory Response Syndrome	Associate	25347003
Takayasu Arteritis	Associate	35126357
Thrombosis	Associate	36226612
Tuberculosis Pulmonary	Associate	34275341
Ureaplasma Infections	Associate	23518821
Uterine Cervical Neoplasms	Stimulate	39208235
Vaginal Neoplasms	Associate	29286178

TLR6 (toll like receptor 6)