Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1033
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase inhibitor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDKN3
Synonyms (NCBI Gene) Gene synonyms aliases	CDI1, CIP2, KAP, KAP1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK

Show/Hide all(125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005705	hsa-miR-146a-5p	Western blot	19944095
MIRT024518	hsa-miR-215-5p	Microarray	19074876
MIRT026751	hsa-miR-192-5p	Microarray	19074876
MIRT049159	hsa-miR-92a-3p	CLASH	23622248
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT2198004	hsa-miR-146a	CLIP-seq
MIRT2198005	hsa-miR-146b-5p	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT2198006	hsa-miR-3123	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT2198007	hsa-miR-3925-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YBX1	Activation	20596676

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	8242750
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8127873
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	12745075
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	8242750
GO:0005515	Function	Protein binding	IPI	8242750, 9840943, 11463386, 15530371, 15671017, 24218572, 25852190
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0007050	Process	Cell cycle arrest	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IDA	8242750
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS	8242750
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8242750
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10669749
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

MIM	HGNC	e!Ensembl
123832	1791	ENSG00000100526

Protein

UniProt ID

Q16667

Protein name

Cyclin-dependent kinase inhibitor 3 (EC 3.1.3.16) (EC 3.1.3.48) (CDK2-associated dual-specificity phosphatase) (Cyclin-dependent kinase interactor 1) (Cyclin-dependent kinase-interacting protein 2) (Kinase-associated phosphatase)

Protein function

May play a role in cell cycle regulation. Dual specificity CC phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues (PubMed:8127873, PubMed:8242750). Dephosphorylates CDK2 at 'Thr-160' in a cyclin-depen

PDB

1FPZ , 1FQ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05706	CDKN3	1 → 168	Cyclin-dependent kinase inhibitor 3 (CDKN3)	Domain

Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

Sequence length

212

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Dental caries	Dental caries		GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Myopia	Myopia		GWAS

Show/Hide Text Mining Associations (66)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Follicular	Associate	32093341
Adenocarcinoma of Lung	Associate	26554648, 28381877, 31698633, 35571564
Adjustment Disorders	Associate	21453471
Adrenocortical Carcinoma	Associate	32147961
Asthma	Associate	15860714
Ataxia Telangiectasia	Associate	22713662, 25032865
Brain Neoplasms	Inhibit	23775190
Breast Neoplasms	Associate	27314680, 39738567
Carcinogenesis	Associate	27314282, 27983933, 9365157
Carcinoma Hepatocellular	Associate	21535270, 22539975, 27314282, 29843214, 29962817, 30702595, 31043166, 31822116, 32000807, 32721244, 33688500, 33784984, 33946043, 34315286, 35030478
Carcinoma Non Small Cell Lung	Associate	23357979, 30709424, 34637697
Carcinoma Non Small Cell Lung	Stimulate	26554648
Carcinoma Ovarian Epithelial	Associate	26191143
Carcinoma Renal Cell	Associate	35678231, 37682177
Carcinoma Squamous Cell	Associate	9889406
Carcinoma Transitional Cell	Associate	11720438
Cerebral Infarction	Associate	28716248
Choline Deficiency	Associate	15147518
Colorectal Neoplasms	Associate	18360708, 32329836
COVID 19	Associate	37278873
Disease Progression	Stimulate	39738567
Esophageal Squamous Cell Carcinoma	Associate	26004606, 34044866, 36259348
Fanconi Anemia	Associate	21685936
Glassy cell carcinoma of the cervix	Associate	14584070
Heart Diseases	Associate	38030294
Hematologic Neoplasms	Associate	10498617
Hernia Inguinal	Associate	34392144
Hodgkin Disease	Associate	21453471
Hyperparathyroidism	Associate	18288099
Hypomagnesemia primary	Associate	23405241
Hypoxia	Associate	34637697, 36140669
Infertility Male	Associate	34580317
Inflammation	Associate	16802342, 37682177, 38030294
Leukemia Prolymphocytic T Cell	Associate	16565223
Liver Cirrhosis	Associate	21535270, 32000807
Lung Neoplasms	Associate	35178291
Lymphatic Metastasis	Associate	34044866
Lymphoma Follicular	Associate	21453471
Lymphoma Large B Cell Diffuse	Associate	21453471
Mouth Neoplasms	Associate	34083581
Multiple Endocrine Neoplasia	Associate	23505216
Multiple Endocrine Neoplasia Type 1	Associate	18288099, 19141585
Multiple Myeloma	Associate	11278272, 11886382
Myocardial Infarction	Associate	38030294
Nasopharyngeal Carcinoma	Associate	30013440
Neoplasm Metastasis	Associate	23548070
Neoplasms	Associate	15640349, 19141585, 21535270, 23117580, 23357979, 23505216, 23548070, 26191143, 26554648, 27314282, 28381877, 30013440, 33351778, 34044866, 34135559 View all (5 more)
Neoplasms	Inhibit	16374457, 22369755, 23775190, 27029014, 35678231
Neoplasms	Stimulate	26372210
Neoplasms Squamous Cell	Associate	34044866
Neuroblastoma	Associate	28246384
Neuroendocrine Tumors	Associate	24185511
Niemann Pick Disease Type C	Stimulate	30013440
Obesity	Associate	39256343
Ovarian Neoplasms	Associate	26191143
Pancreatic Neoplasms	Associate	18190706, 35864471, 36828188, 7573363
Parathyroid Neoplasms	Associate	23715670
Pituitary Neoplasms	Associate	9365157
Prostatic Neoplasms	Associate	33630978, 34198380
Silicosis	Associate	37278873
Small Cell Lung Carcinoma	Associate	29845250
Stomach Neoplasms	Associate	23548070, 27983933, 33351778, 34135559
Stomach Neoplasms	Stimulate	35446856
Uterine Cervical Dysplasia	Associate	15492761, 35008799
Uterine Cervical Neoplasms	Associate	23405241, 26372210
Wounds and Injuries	Associate	38030294

CDKN3 (cyclin dependent kinase inhibitor 3)