Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1032
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase inhibitor 2D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDKN2D
Synonyms (NCBI Gene) Gene synonyms aliases	INK4D, p19, p19-INK4D
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth re

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024530	hsa-miR-215-5p	Microarray	19074876
MIRT026171	hsa-miR-192-5p	Microarray	19074876
MIRT028887	hsa-miR-26b-5p	Microarray	19088304
MIRT043416	hsa-miR-331-3p	CLASH	23622248
MIRT733490	hsa-miR-451a	Luciferase reporter assay, Western blot	26019450
MIRT733472	hsa-miR-486-5p	RNA-seq	34199766
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT736370	hsa-miR-18a-3p	qRT-PCR	32382354
MIRT881882	hsa-miR-3689d	CLIP-seq
MIRT881883	hsa-miR-4254	CLIP-seq
MIRT881884	hsa-miR-4292	CLIP-seq
MIRT881885	hsa-miR-4308	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq
MIRT881887	hsa-miR-645	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	8741839
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	10208428
GO:0000731	Process	DNA synthesis involved in DNA repair	IMP	15750620
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8741839
GO:0005515	Function	Protein binding	IPI	9751050, 16189514, 21516116, 23602568, 24981860, 25416956, 25910212, 27107012, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	8741839, 15750620
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15750620
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007050	Process	Cell cycle arrest	IDA	10208428
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10208428
GO:0009411	Process	Response to UV	IMP	15750620
GO:0019901	Function	Protein kinase binding	IPI	8741839
GO:0030308	Process	Negative regulation of cell growth	IDA	10208428
GO:0032526	Process	Response to retinoic acid	IMP	16322758
GO:0033280	Process	Response to vitamin D	IMP	16322758
GO:0042326	Process	Negative regulation of phosphorylation	IDA	10208428
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	15750620
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0048102	Process	Autophagic cell death	IMP	16322758
GO:0097129	Component	Cyclin D2-CDK4 complex	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15750620
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	TAS

MIM	HGNC	e!Ensembl
600927	1790	ENSG00000129355

Protein

UniProt ID

P55273

Protein name

Cyclin-dependent kinase 4 inhibitor D (p19-INK4d)

Protein function

Interacts strongly with CDK4 and CDK6 and inhibits them.

PDB

1BD8 , 1BI8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	12 → 104	Ankyrin repeats (3 copies)	Repeat

Sequence

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Sequence length

166

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle		Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) Oncogene Induced Senescence Cyclin D associated events in G1

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16367923

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	9736735
Carcinoma Hepatocellular	Associate	35771229
Colorectal Neoplasms	Associate	16369045
Death	Associate	23462184
Esophageal Neoplasms	Associate	26019450
Glioma	Associate	12698196
Hyperplasia	Associate	23775078
Hypoxia	Associate	28729699
Idiopathic Pulmonary Fibrosis	Associate	20451601
Leukemia Lymphoma Adult T Cell	Associate	37461070
Leukemia Myeloid	Associate	10468852
Leukemia Promyelocytic Acute	Associate	25275592
Melanoma	Associate	10390011
Multiple Myeloma	Associate	9565604
Neoplasms	Inhibit	10734227
Neoplasms	Associate	23775078, 24022213, 24455688, 24675677, 9013872, 9782052
Neuroblastoma	Associate	28246384
Osteosarcoma	Associate	9782052
Ovarian Neoplasms	Associate	24022213, 24675677, 28653900
Parathyroid Neoplasms	Associate	23715670
Parkinson Disease	Associate	22651796
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10468852
Pyruvate Carboxylase Deficiency Disease	Associate	24022213
Squamous Cell Carcinoma of Head and Neck	Associate	19430297
Thyroid cancer medullary	Associate	29066476

CDKN2D (cyclin dependent kinase inhibitor 2D)