CDKN2D (cyclin dependent kinase inhibitor 2D)

Gene

• Entrez ID: 1032
• Gene name: Cyclin dependent kinase inhibitor 2D
• Gene symbol: CDKN2D
• Synonyms (NCBI Gene): INK4D, p19, p19-INK4D
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024530	hsa-miR-215-5p	Microarray	19074876
MIRT026171	hsa-miR-192-5p	Microarray	19074876
MIRT028887	hsa-miR-26b-5p	Microarray	19088304
MIRT043416	hsa-miR-331-3p	CLASH	23622248
MIRT733490	hsa-miR-451a	Luciferase reporter assay, Western blot	26019450
MIRT733472	hsa-miR-486-5p	RNA-seq	34199766
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT736370	hsa-miR-18a-3p	qRT-PCR	32382354
MIRT881882	hsa-miR-3689d	CLIP-seq
MIRT881883	hsa-miR-4254	CLIP-seq
MIRT881884	hsa-miR-4292	CLIP-seq
MIRT881885	hsa-miR-4308	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq
MIRT881887	hsa-miR-645	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000731	Process	DNA synthesis involved in DNA repair	IMP	15750620
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8741839
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	TAS	10208428
GO:0005515	Function	Protein binding	IPI	9751050, 16189514, 21516116, 23602568, 24981860, 25416956, 25910212, 27107012, 28514442, 31515488, 32296183, 32707033, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8741839, 15750620
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15750620
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10208428
GO:0009411	Process	Response to UV	IMP	15750620
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8741839
GO:0030308	Process	Negative regulation of cell growth	IDA	10208428
GO:0032526	Process	Response to retinoic acid	IMP	16322758
GO:0033280	Process	Response to vitamin D	IMP	16322758
GO:0048102	Process	Autophagic cell death	IMP	16322758
GO:0097129	Component	Cyclin D2-CDK4 complex	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15750620
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IEA
GO:1902807	Process	Negative regulation of cell cycle G1/S phase transition	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	10208428
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	8741839

Other IDs

• MIM: 600927
• HGNC: 1790
• e!Ensembl: ENSG00000129355

Protein

• UniProt ID: P55273
• Protein name: Cyclin-dependent kinase 4 inhibitor D (p19-INK4d)
• Protein function: Interacts strongly with CDK4 and CDK6 and inhibits them.
• PDB: 1BD8, 1BI8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	12 → 104	Ankyrin repeats (3 copies)	Repeat

• Sequence:

  MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
  LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
  AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

• Sequence length: 166

Pathways

KEGG:

FoxO signaling pathway
Cell cycle

Reactome:

Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
Cyclin D associated events in G1

<