Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10318
Gene name Gene Name - the full gene name approved by the HGNC.	TNFAIP3 interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNIP1
Synonyms (NCBI Gene) Gene synonyms aliases	ABIN-1, NAF1, VAN, nip40-1
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an A20-binding protein which plays a role in autoimmunity and tissue homeostasis through the regulation of nuclear factor kappa-B activation. Mutations in this gene have been associated with psoriatic arthritis, rheumatoid arthritis, and

Show/Hide all(154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024151	hsa-miR-221-3p	Sequencing	20371350
MIRT047340	hsa-miR-181a-5p	CLASH	23622248
MIRT042899	hsa-miR-324-3p	CLASH	23622248
MIRT438115	hsa-miR-517a-3p	Luciferase reporter assay	23448136
MIRT438115	hsa-miR-517a-3p	Luciferase reporter assay	23448136
MIRT518709	hsa-miR-582-3p	HITS-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518709	hsa-miR-582-3p	PAR-CLIP	23446348
MIRT518708	hsa-miR-625-3p	PAR-CLIP	23446348
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518706	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT726260	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726259	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT518709	hsa-miR-582-3p	HITS-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518709	hsa-miR-582-3p	PAR-CLIP	23446348
MIRT518708	hsa-miR-625-3p	PAR-CLIP	23446348
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518706	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1443619	hsa-miR-1255a	CLIP-seq
MIRT1443620	hsa-miR-1255b	CLIP-seq
MIRT1443621	hsa-miR-19a	CLIP-seq
MIRT1443622	hsa-miR-19b	CLIP-seq
MIRT1443623	hsa-miR-3183	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT1443625	hsa-miR-4723-3p	CLIP-seq
MIRT1443626	hsa-miR-4757-5p	CLIP-seq
MIRT1443627	hsa-miR-517a	CLIP-seq
MIRT1443628	hsa-miR-517b	CLIP-seq
MIRT1443629	hsa-miR-517c	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2132749	hsa-miR-221	CLIP-seq
MIRT2132750	hsa-miR-222	CLIP-seq
MIRT2132751	hsa-miR-2467-5p	CLIP-seq
MIRT2132752	hsa-miR-3188	CLIP-seq
MIRT2132753	hsa-miR-370	CLIP-seq
MIRT2132754	hsa-miR-3975	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2132757	hsa-miR-4649-3p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2132759	hsa-miR-4736	CLIP-seq
MIRT2132760	hsa-miR-4797-5p	CLIP-seq
MIRT2132761	hsa-miR-485-5p	CLIP-seq
MIRT2132762	hsa-miR-486-3p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2132764	hsa-miR-548v	CLIP-seq
MIRT2132765	hsa-miR-760	CLIP-seq
MIRT2353838	hsa-miR-1299	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2353840	hsa-miR-4701-5p	CLIP-seq
MIRT2353841	hsa-miR-4782-5p	CLIP-seq
MIRT2353842	hsa-miR-516b	CLIP-seq
MIRT2353843	hsa-miR-588	CLIP-seq
MIRT2396142	hsa-miR-1910	CLIP-seq
MIRT2396143	hsa-miR-2355-5p	CLIP-seq
MIRT2396144	hsa-miR-30a	CLIP-seq
MIRT2396145	hsa-miR-30b	CLIP-seq
MIRT2396146	hsa-miR-30c	CLIP-seq
MIRT2396147	hsa-miR-30d	CLIP-seq
MIRT2396148	hsa-miR-30e	CLIP-seq
MIRT2396149	hsa-miR-3607-3p	CLIP-seq
MIRT2396150	hsa-miR-486-5p	CLIP-seq
MIRT2647949	hsa-miR-1182	CLIP-seq
MIRT2647950	hsa-miR-1252	CLIP-seq
MIRT2647951	hsa-miR-1266	CLIP-seq
MIRT2647952	hsa-miR-140-3p	CLIP-seq
MIRT2647953	hsa-miR-150	CLIP-seq
MIRT2647954	hsa-miR-193a-5p	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2647955	hsa-miR-3156-3p	CLIP-seq
MIRT2647956	hsa-miR-3159	CLIP-seq
MIRT2647957	hsa-miR-3179	CLIP-seq
MIRT2647958	hsa-miR-3202	CLIP-seq
MIRT2647959	hsa-miR-3675-5p	CLIP-seq
MIRT2647960	hsa-miR-3918	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2647961	hsa-miR-4268	CLIP-seq
MIRT2647962	hsa-miR-4301	CLIP-seq
MIRT2647963	hsa-miR-4448	CLIP-seq
MIRT2647964	hsa-miR-4476	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2647965	hsa-miR-4518	CLIP-seq
MIRT2647966	hsa-miR-4539	CLIP-seq
MIRT2647967	hsa-miR-4650-5p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2647968	hsa-miR-4679	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT2647969	hsa-miR-4713-5p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2647970	hsa-miR-604	CLIP-seq
MIRT2647971	hsa-miR-615-5p	CLIP-seq
MIRT2647972	hsa-miR-647	CLIP-seq
MIRT2647973	hsa-miR-651	CLIP-seq
MIRT2647974	hsa-miR-766	CLIP-seq
MIRT2647949	hsa-miR-1182	CLIP-seq
MIRT2647950	hsa-miR-1252	CLIP-seq
MIRT2647951	hsa-miR-1266	CLIP-seq
MIRT2647952	hsa-miR-140-3p	CLIP-seq
MIRT2647953	hsa-miR-150	CLIP-seq
MIRT2647954	hsa-miR-193a-5p	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2693752	hsa-miR-2861	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2647955	hsa-miR-3156-3p	CLIP-seq
MIRT2647956	hsa-miR-3159	CLIP-seq
MIRT2647957	hsa-miR-3179	CLIP-seq
MIRT2647958	hsa-miR-3202	CLIP-seq
MIRT2693753	hsa-miR-3612	CLIP-seq
MIRT2647959	hsa-miR-3675-5p	CLIP-seq
MIRT2693754	hsa-miR-3690	CLIP-seq
MIRT2647960	hsa-miR-3918	CLIP-seq
MIRT2693755	hsa-miR-4254	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2647961	hsa-miR-4268	CLIP-seq
MIRT2647962	hsa-miR-4301	CLIP-seq
MIRT2693756	hsa-miR-4443	CLIP-seq
MIRT2647963	hsa-miR-4448	CLIP-seq
MIRT2647964	hsa-miR-4476	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2693757	hsa-miR-4512	CLIP-seq
MIRT2647965	hsa-miR-4518	CLIP-seq
MIRT2647966	hsa-miR-4539	CLIP-seq
MIRT2647967	hsa-miR-4650-5p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2647968	hsa-miR-4679	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT2647969	hsa-miR-4713-5p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2647970	hsa-miR-604	CLIP-seq
MIRT2647971	hsa-miR-615-5p	CLIP-seq
MIRT2647972	hsa-miR-647	CLIP-seq
MIRT2693758	hsa-miR-650	CLIP-seq
MIRT2647973	hsa-miR-651	CLIP-seq
MIRT2647974	hsa-miR-766	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0005515	Function	Protein binding	IPI	15474016, 16189514, 20010814, 21516116, 21988832, 23414517, 25416956, 25609649, 25910212, 26871637, 29892012, 30561431, 31515488, 32296183, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006412	Process	Translation	TAS	9923610
GO:0006952	Process	Defense response	TAS	9923610
GO:0006954	Process	Inflammatory response	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	17632516
GO:0009101	Process	Glycoprotein biosynthetic process	IDA	9923610
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 25416956, 30561431, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IBA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	16684768
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0045071	Process	Negative regulation of viral genome replication	TAS	9923610
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA
GO:0051019	Function	Mitogen-activated protein kinase binding	IDA	12220502
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12220502
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:1903003	Process	Positive regulation of protein deubiquitination	IDA	16684768

MIM	HGNC	e!Ensembl
607714	16903	ENSG00000145901

Protein

UniProt ID

Q15025

Protein name

TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN)

Protein function

Inhibits NF-kappa-B activation and TNF-induced NF-kappa-B-dependent gene expression by regulating TAX1BP1 and A20/TNFAIP3-mediated deubiquitination of IKBKG; proposed to link A20/TNFAIP3 to ubiquitinated IKBKG (PubMed:21885437). Involved in regu

PDB

7EAL , 7EAO , 7EB9 , 8YFK , 8YFL , 8YFM , 8YFN , 9D34

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain. In peripheral blood mononucleocytes, isoform 4 is mainly expressed and isoform 1 and isoform 7 are almost

Sequence

MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLR
QKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSG
TSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQL
FTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERL
REENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAE
KKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQ
RDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDR
ERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPH
PEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRL
PCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Sequence length

636

Interactions

View interactions

	KEGG		Reactome
	Shigellosis		Ovarian tumor domain proteases

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	N/A	N/A	GWAS
Myasthenia Gravis	Myasthenia gravis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	N/A	N/A	GWAS
Systemic lupus erythematosus	systemic lupus erythematosus, Systemic lupus erythematosus	N/A	N/A	GenCC, GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthralgia	Associate	37280058
Arthritis Psoriatic	Associate	21623003, 22298274
Arthritis Rheumatoid	Associate	20849588
Asthma	Associate	22694930
Autoimmune Diseases	Associate	23944604, 31804013, 32231389
Bronchiolitis	Associate	37751795
Carcinoma Hepatocellular	Associate	33761643
CD59 Deficiency	Associate	25397881
Esophageal Neoplasms	Associate	28454086
Exanthema	Associate	30543901
Hepatitis C	Associate	26382585
Hippocampal Sclerosis	Associate	36191742
Inflammation	Associate	22694930, 27371733, 40018940
Inflammation	Inhibit	30543901, 40149990
Kidney Diseases	Associate	20849588
Lupus Erythematosus Systemic	Stimulate	19838195
Lupus Erythematosus Systemic	Associate	20849588, 22087647, 22694930, 22833143, 26606652, 29070082, 31804013
Lupus Nephritis	Associate	24386384
Multiple Trauma	Associate	23944604
Myasthenia Gravis	Associate	23055271, 34279044
Neoplasms	Associate	19277210
Non Muscle Invasive Bladder Neoplasms	Associate	27197286
Psoriasis	Associate	19169254, 22298274, 22694930, 25574825, 27364786, 30543901
Respiratory Syncytial Virus Infections	Associate	37751795
Scleroderma Systemic	Associate	22694930, 32977850
Sjogren's Syndrome	Associate	23944604, 24097067, 29070082
Stomach Neoplasms	Associate	27250029, 30114685, 32502020
Stomach Neoplasms	Stimulate	32502020
Uveomeningoencephalitic Syndrome	Associate	24788730

TNIP1 (TNFAIP3 interacting protein 1)