Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10312
Gene name Gene Name - the full gene name approved by the HGNC.
T cell immune regulator 1, ATPase H+ transporting V0 subunit a3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCIRG1
Synonyms (NCBI Gene) Gene synonyms aliases
ATP6N1C, ATP6V0A3, Atp6i, OC-116kDa, OC116, OPTB1, Stv1, TIRC7, Vph1, a3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of a large protein complex known as a vacuolar H+-ATPase (V-ATPase). The protein complex acts as a pump to move protons across the membrane. This movement of protons helps regulate the pH of cells and their surrounding environm
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853149 C>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant, missense variant
rs137853150 G>A,C Pathogenic-likely-pathogenic, pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs137853151 G>A,T Pathogenic Coding sequence variant, synonymous variant, non coding transcript variant, missense variant
rs138527421 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, synonymous variant, non coding transcript variant, missense variant
rs139617644 G>A Pathogenic Splice acceptor variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IEA
GO:0000220 Component Vacuolar proton-transporting V-type ATPase, V0 domain IEA
GO:0001503 Process Ossification IEA
GO:0002158 Process Osteoclast proliferation IEA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604592 11647 ENSG00000110719
Protein
UniProt ID Q13488
Protein name V-type proton ATPase 116 kDa subunit a 3 (V-ATPase 116 kDa subunit a 3) (Osteoclastic proton pump 116 kDa subunit) (OC-116 kDa) (OC116) (T-cell immune regulator 1) (T-cell immune response cDNA7 protein) (TIRC7) (Vacuolar proton translocating ATPase 116 kD
Protein function Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (By similarity). V-ATPase is responsible
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01496 V_ATPase_I 27 825 V-type ATPase 116kDa subunit family Family
Tissue specificity TISSUE SPECIFICITY: Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus.
Sequence
MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEE
LEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRA
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAP
ALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFH
CHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMK
AVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPT
LIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAM
VLAENRPAVKAAQNEIWQTFFRGRYLLLLMGLFSIYTGFIYNECFSRATSIFPSGWSVAA
MANQSGWSDAFLAQHTMLTLDPNVTGVFLGPYPFGIDPIWSLAANHLSFLNSFKMKMSVI
LGVVHMAFGVVLGVFNHVHFGQRHRLLLETLPELTFLLGLFGYLVFLVIYKWLCVWAARA
ASAPSILIHFINMFLFSHSPSNRLLYPRQEVVQATLVVLALAMVPILLLGTPLHLLHRHR
RRLRRRPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHT
IEFCLGCVSNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGLGREVGVAAVVLVPIFAAF
AVMTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTF
AATDD
Sequence length 830
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Human papillomavirus infection
Rheumatoid arthritis
  ROS and RNS production in phagocytes
Neutrophil degranulation
Insulin receptor recycling
Transferrin endocytosis and recycling
Amino acids regulate mTORC1
Ion channel transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Osteopetrosis Autosomal recessive osteopetrosis 1, osteopetrosis rs1565156743, rs1458295257, rs1554995582, rs2134438856, rs1385741705, rs1590817956, rs1554997884, rs1554995706, rs139617644, rs1554995522, rs200851583, rs1554997818, rs1392364437, rs1590819834, rs1554998061
View all (35 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital Neutropenia Neutropenia, severe congenital, 1, autosomal dominant N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Renal Tubular Associate 12566520
Adenocarcinoma Mucinous Associate 1928301
Adenocarcinoma of Lung Associate 25233467
Agammaglobulinemia Associate 19507210
alpha Thalassemia Associate 25834820
Alzheimer Disease Associate 30478411, 35699875
Atherosclerosis Associate 27229898
Barrett Esophagus Associate 20543560
Bisphosphonate Associated Osteonecrosis of the Jaw Associate 32119750
Bone Diseases Metabolic Associate 20424301, 24535816