DLEU1 (deleted in lymphocytic leukemia 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 10301
Gene name Deleted in lymphocytic leukemia 1
Gene symbol DLEU1
Synonyms (NCBI Gene)
BCMSBCMS1DLB1DLEU2LEU1LEU2LINC00021NCRNA00021XTP6
Chromosome 13
Chromosome location 13q14.2-q14.3
miRNA miRNA information provided by mirtarbase database.
162
Gene miRNA Other IDs Protein
Show/Hide all (162)
miRTarBase ID miRNA Experiments Reference
MIRT717140 hsa-miR-124-3p HITS-CLIP 19536157
MIRT717150 hsa-miR-3714 HITS-CLIP 19536157
MIRT717149 hsa-miR-3910 HITS-CLIP 19536157
MIRT717148 hsa-miR-6808-5p HITS-CLIP 19536157
MIRT717147 hsa-miR-6893-5p HITS-CLIP 19536157
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
605765 13747 ENSG00000176124
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43261
Protein name Leukemia-associated protein 1 (Deleted in lymphocytic leukemia 1) (HBV X-transactivated gene 6 protein) (HBV XAg-transactivated protein 6)
Protein function May act as a tumor suppressor.
Family and domains
Sequence 
MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNAD
KYQMGDCCKEEIDDSIFY
Sequence length 78
Interactions View interactions