Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10300
Gene name Gene Name - the full gene name approved by the HGNC.
Katanin regulatory subunit B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KATNB1
Synonyms (NCBI Gene) Gene synonyms aliases
KAT, LIS6
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q21
Summary Summary of gene provided in NCBI Entrez Gene.
Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs730880257 C>T Pathogenic Missense variant, coding sequence variant
rs730880258 T>G Pathogenic Missense variant, coding sequence variant
rs730880259 G>A,T Pathogenic Missense variant, coding sequence variant
rs879255517 C>- Pathogenic Frameshift variant, coding sequence variant
rs879255519 G>A Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051547 hsa-let-7e-5p CLASH 23622248
MIRT050360 hsa-miR-25-3p CLASH 23622248
MIRT043768 hsa-miR-328-3p CLASH 23622248
MIRT1079225 hsa-miR-15a CLIP-seq
MIRT1079226 hsa-miR-15b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IDA 10751153, 26929214
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 24486153, 26496610, 26929214, 28514442, 32814053, 33961781
GO:0005634 Component Nucleus HDA 21630459
GO:0005737 Component Cytoplasm IDA 10751153, 26929214
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602703 6217 ENSG00000140854
Protein
UniProt ID Q9BVA0
Protein name Katanin p80 WD40 repeat-containing subunit B1 (Katanin p80 subunit B1) (p80 katanin)
Protein function Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 10 49 WD domain, G-beta repeat Repeat
PF00400 WD40 53 91 WD domain, G-beta repeat Repeat
PF00400 WD40 95 133 WD domain, G-beta repeat Repeat
PF00400 WD40 137 175 WD domain, G-beta repeat Repeat
PF00400 WD40 179 217 WD domain, G-beta repeat Repeat
PF13925 Katanin_con80 493 651 con80 domain of Katanin Domain
Sequence
MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLT
GHTSPVESVRLNTPEELIVAGSQSGSIRVWD
LEAAKILRTLMGHKANICSLDFHPYGEFV
ASGSQDTNIKLWD
IRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGK
MMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWD
LEKFQVVSCIEGEPGPVRSVLFN
PDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVV
DLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRS
PSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKP
SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQA
ELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDL
LNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAP
PSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLM
ASLD
Sequence length 655
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Lissencephaly with microcephaly lissencephaly 6 with microcephaly rs730880257, rs730880258, rs879255517, rs879255518, rs730880259, rs879255519 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Microlissencephaly microlissencephaly N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 23894477
Aortic Aneurysm Abdominal Associate 26767057
Bronchiolitis Obliterans Syndrome Associate 20654580
Central Nervous System Vascular Malformations Associate 34202629
Diffuse Cerebral Sclerosis of Schilder Associate 31484711
Lung Diseases Associate 36934373
Lung Neoplasms Associate 36934373
Microcephaly Associate 34202629
Neoplasms Associate 36934373
Paraplegia Associate 23894477