CDKN2B (cyclin dependent kinase inhibitor 2B)

Gene

• Entrez ID: 1030
• Gene name: Cyclin dependent kinase inhibitor 2B
• Gene symbol: CDKN2B
• Synonyms (NCBI Gene): CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the ac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016027	hsa-miR-374b-5p	Sequencing	20371350
MIRT019955	hsa-miR-375	Microarray	20215506
MIRT027714	hsa-miR-98-5p	Microarray	19088304
MIRT704749	hsa-miR-3617-5p	HITS-CLIP	23313552
MIRT704748	hsa-miR-641	HITS-CLIP	23313552
MIRT704747	hsa-miR-6895-5p	HITS-CLIP	23313552
MIRT704746	hsa-miR-3659	HITS-CLIP	23313552
MIRT704745	hsa-miR-4640-5p	HITS-CLIP	23313552
MIRT704744	hsa-miR-4726-5p	HITS-CLIP	23313552
MIRT704743	hsa-miR-4792	HITS-CLIP	23313552
MIRT704742	hsa-miR-4710	HITS-CLIP	23313552
MIRT704741	hsa-miR-4790-5p	HITS-CLIP	23313552
MIRT704740	hsa-miR-4658	HITS-CLIP	23313552
MIRT704739	hsa-miR-6790-5p	HITS-CLIP	23313552
MIRT704738	hsa-miR-7855-5p	HITS-CLIP	23313552
MIRT736770	hsa-miR-761	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	32336677
MIRT738198	hsa-miR-3976	HITS-CLIP	33718276
MIRT738199	hsa-miR-4662a-3p	HITS-CLIP	33718276
MIRT704749	hsa-miR-3617-5p	HITS-CLIP	23313552
MIRT704748	hsa-miR-641	HITS-CLIP	23313552
MIRT704747	hsa-miR-6895-5p	HITS-CLIP	23313552
MIRT704746	hsa-miR-3659	HITS-CLIP	23313552
MIRT704745	hsa-miR-4640-5p	HITS-CLIP	23313552
MIRT704744	hsa-miR-4726-5p	HITS-CLIP	23313552
MIRT704743	hsa-miR-4792	HITS-CLIP	23313552
MIRT704742	hsa-miR-4710	HITS-CLIP	23313552
MIRT704741	hsa-miR-4790-5p	HITS-CLIP	23313552
MIRT704740	hsa-miR-4658	HITS-CLIP	23313552
MIRT704739	hsa-miR-6790-5p	HITS-CLIP	23313552
MIRT704738	hsa-miR-7855-5p	HITS-CLIP	23313552
MIRT881854	hsa-miR-132	CLIP-seq
MIRT881855	hsa-miR-144	CLIP-seq
MIRT881856	hsa-miR-212	CLIP-seq
MIRT881857	hsa-miR-3130-5p	CLIP-seq
MIRT881858	hsa-miR-3167	CLIP-seq
MIRT881859	hsa-miR-4308	CLIP-seq
MIRT881860	hsa-miR-433	CLIP-seq
MIRT881861	hsa-miR-4482	CLIP-seq
MIRT881862	hsa-miR-4733-5p	CLIP-seq
MIRT881863	hsa-miR-4775	CLIP-seq
MIRT881864	hsa-miR-495	CLIP-seq
MIRT881865	hsa-miR-520d-5p	CLIP-seq
MIRT881866	hsa-miR-524-5p	CLIP-seq
MIRT881867	hsa-miR-556-3p	CLIP-seq
MIRT881868	hsa-miR-556-5p	CLIP-seq
MIRT881869	hsa-miR-590-3p	CLIP-seq
MIRT881870	hsa-miR-605	CLIP-seq
MIRT881871	hsa-miR-656	CLIP-seq
MIRT881872	hsa-miR-875-3p	CLIP-seq
MIRT881873	hsa-miR-876-5p	CLIP-seq
MIRT881874	hsa-miR-944	CLIP-seq
MIRT881875	hsa-miR-204	CLIP-seq
MIRT881876	hsa-miR-211	CLIP-seq
MIRT881877	hsa-miR-3143	CLIP-seq
MIRT881878	hsa-miR-4446-5p	CLIP-seq
MIRT881879	hsa-miR-4755-5p	CLIP-seq
MIRT881880	hsa-miR-543	CLIP-seq
MIRT881881	hsa-miR-623	CLIP-seq
MIRT1961263	hsa-miR-1256	CLIP-seq
MIRT1961264	hsa-miR-3161	CLIP-seq
MIRT1961265	hsa-miR-4666-5p	CLIP-seq
MIRT881863	hsa-miR-4775	CLIP-seq
MIRT1961266	hsa-miR-4802-3p	CLIP-seq
MIRT881869	hsa-miR-590-3p	CLIP-seq
MIRT2197998	hsa-miR-4685-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	22723377
DNMT1	Unknown	19545050
EP300	Unknown	19419955;22000024
EZH2	Repression	21697275
FOXO3	Unknown	19419955
KLF5	Unknown	19419955
SMAD4	Unknown	19419955
SMAD7	Repression	15555279
SP1	Unknown	10649433;7592908
SP3	Unknown	10649433;7592908
STAT5A	Repression	22723377
ZBTB17	Unknown	22000024

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	8078588
GO:0000086	Process	G2/M transition of mitotic cell cycle	IMP	17553787
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8078588
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	NAS	9230210
GO:0005515	Function	Protein binding	IPI	16169070, 16189514, 19447967, 21900206, 23455922, 23602568, 24981860, 25416956, 25910212, 26496610, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	9230210, 18564286
GO:0005737	Component	Cytoplasm	IDA	9230210, 16943770
GO:0005829	Component	Cytosol	TAS
GO:0007050	Process	Cell cycle arrest	IMP	17553787
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17553787
GO:0019901	Function	Protein kinase binding	IPI	8078588
GO:0030219	Process	Megakaryocyte differentiation	IEP	10812241
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IMP	16943770
GO:0031668	Process	Cellular response to extracellular stimulus	IMP	17553787
GO:0031670	Process	Cellular response to nutrient	IMP	17597576
GO:0042326	Process	Negative regulation of phosphorylation	IDA	8078588
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0048536	Process	Spleen development	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IMP	16943770
GO:0070316	Process	Regulation of G0 to G1 transition	IMP	17553787
GO:0090398	Process	Cellular senescence	IMP	17553787
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	TAS

Other IDs

• MIM: 600431
• HGNC: 1788
• e!Ensembl: ENSG00000147883

Protein

• UniProt ID: P42772
• Protein name: Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B)
• Protein function: Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines. {ECO:0000269|PubMed:9230210}.
• Sequence:

  MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
  VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
  EERGHRDVAGYLRTATGD

• Sequence length: 138

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
Cellular senescence
TGF-beta signaling pathway
Cushing syndrome
Human T-cell leukemia virus 1 infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Gastric cancer

Reactome:

SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
Cyclin D associated events in G1

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Adrenocortical adenoma	Adrenal Cortical Adenoma	rs121913035
Adrenocortical carcinoma	Adrenocortical carcinoma	rs121912656, rs28934874, rs121912662, rs786202525, rs121912664, rs397516435, rs121913343, rs587780070, rs121912666, rs55832599, rs587782144, rs587782272, rs587782529, rs587782620, rs587782664, rs587782705, rs193920817, rs55863639, rs730882029, rs730882005, rs730882025, rs730881999, rs786201838, rs786202962, rs863224451, rs863224499, rs760043106, rs11540652, rs11540654, rs876658483, rs587781525, rs1057519986, rs1057519989, rs530941076, rs1060501197, rs1064792930, rs1064794618, rs1131691042, rs1555526131, rs1057519990, rs1555526097, rs1567554500, rs1131691039, rs1202793339, rs769697802
Angiofibroma	Angiofibroma	rs121913034, rs267607234
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039
Hyperinsulinemic hypoglycemia	Congenital Hyperinsulinism, Hyperinsulinemic hypoglycemia	rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402, rs980458021, rs375717077, rs786200932, rs587783169, rs72559713, rs72559716, rs786204542, rs541269678, rs570388861, rs72559722, rs786204676, rs151344624, rs797045637, rs797045212, rs797045211, rs797045207, rs797045213, rs761749884, rs863225280, rs139964066, rs886039877, rs886041392, rs886041391, rs746480424, rs1057516281, rs1057516317, rs576684889, rs764613146, rs773306994, rs1057516946, rs1057517139, rs1057516591, rs201682634, rs766891274, rs193922405, rs72559715, rs769518471, rs757171524, rs139328569, rs768951263, rs72559718, rs1260178539, rs200670692, rs72559734, rs1554910610, rs1554924035, rs372307320, rs1446306735, rs925231098, rs1554913069, rs1554923999, rs765090096, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1554949176, rs1411638309, rs1008906426, rs758844607, rs1554924540, rs755259997, rs769569410, rs72559730, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1398546361, rs781617345
Coronary artery disease	CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1, Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	23202125, 24262325, 29212778, 23104008
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	30054458
Glaucoma	Glaucoma, Glaucoma, Open-Angle	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328, rs121909193, rs74315330, rs74315329, rs74315332, rs74315334, rs74315336, rs74315338, rs74315341, rs121909194, rs74315331, rs1558603396, rs387907175, rs587778873, rs587778875, rs104894979, rs137854895, rs766425037, rs72549380, rs148542782, rs541217363, rs753021890, rs771076928, rs56010818, rs777678299, rs1446110883, rs1573274915, rs1587545234, rs751768343, rs944452644	21532571, 22792221, 22570617, 22419738
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701	19578367, 19578366, 21531791
Hypercalcemia	Hypercalcemia	rs876657376, rs387907322, rs777676129, rs387907323, rs114368325, rs6068812, rs387907324, rs777947329, rs201304511, rs769409705, rs200095793, rs876661338, rs1554095500, rs139763321, rs774432244, rs781367354
Hyperparathyroidism	Hyperparathyroidism	rs28942098, rs121434262, rs80356649, rs121434264, rs587776558, rs587776559, rs121909259, rs104893689, rs28936684, rs104893690, rs869320729, rs104893700, rs104893705, rs104893707, rs104893709, rs863223311, rs80356650, rs193922432, rs886041637, rs201633414, rs1057519419, rs766719790, rs1281361203, rs759393722, rs1342435095, rs1200458339, rs755916513, rs1586190048, rs1558280170
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044	9488045
Lymphoblastic leukemia	Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591	29348612
Melanoma	melanoma, Familial melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050
Multiple endocrine neoplasia	Multiple Endocrine Neoplasia Type 1, Multiple endocrine neoplasia type 1	rs121917832, rs76262710, rs75076352, rs75996173, rs80069458, rs79781594, rs77316810, rs77503355, rs77709286, rs74799832, rs76764689, rs76449634, rs78014899, rs77939446, rs79890926, rs75030001, rs77558292, rs79658334, rs75873440, rs75234356, rs104894256, rs397515385, rs104894258, rs1555164986, rs869025185, rs104894259, rs104894260, rs104894261, rs28931612, rs104894266, rs104894267, rs587776841, rs104894262, rs104894263, rs1941851693, rs104894264, rs104894265, rs863223311, rs760199250, rs1060499976, rs377767396, rs377767391, rs377767397, rs377767404, rs377767405, rs377767406, rs377767412, rs143795581, rs146646971, rs377767440, rs386134245, rs386134246, rs386134247, rs386134249, rs386134250, rs386134251, rs386134253, rs386134254, rs386134255, rs386134256, rs386134258, rs386134259, rs386134260, rs386134261, rs377767442, rs377767398, rs377767429, rs794728622, rs398124435, rs398124437, rs730882136, rs786201007, rs786201010, rs786201011, rs786204242, rs794728631, rs794728630, rs761695866, rs767319284, rs794728659, rs794728629, rs764570645, rs794728654, rs794728625, rs794728624, rs794728621, rs794728640, rs104894257, rs794728650, rs376872829, rs794728657, rs794728647, rs794728639, rs794728616, rs794728615, rs794728614, rs863224527, rs863224526, rs864622617, rs864622615, rs878855198, rs878855196, rs878855192, rs878855191, rs886039421, rs886039419, rs886039418, rs886039416, rs886039415, rs886039414, rs886039553, rs886039413, rs886041213, rs886041214, rs886042035, rs1057517902, rs1057518572, rs1057521110, rs1057521111, rs794728648, rs1057520733, rs1060500759, rs1060499974, rs750904332, rs1060499973, rs778670301, rs1060499991, rs1060499986, rs1060499992, rs1555166494, rs1555163780, rs1060499981, rs2071312, rs1555166609, rs772588551, rs1060500186, rs1060499987, rs1060499990, rs1555163591, rs1060503789, rs1064793167, rs1064793672, rs1064793613, rs1555166711, rs1085307471, rs1114167510, rs1114167514, rs1114167536, rs1114167531, rs1114167528, rs1114167542, rs1114167524, rs1114167513, rs1060499984, rs767078097, rs1114167489, rs1114167482, rs1114167483, rs1114167508, rs1114167469, rs1114167498, rs794728652, rs1114167499, rs1114167519, rs1114167538, rs1114167515, rs1114167486, rs1114167491, rs1555166695, rs1114167523, rs1555165128, rs1555166387, rs1555165488, rs972128957, rs1555165377, rs1555164270, rs1555165503, rs778921501, rs1555165756, rs141679530, rs1555163883, rs1555164115, rs1555165809, rs1555166466, rs532903617, rs1555085549, rs1555166368, rs1555164430, rs1555165485, rs1555166567, rs1555163646, rs776561706, rs1555166681, rs1555085575, rs1555165360, rs1555166365, rs1555164707, rs1555164946, rs1555164184, rs1565634591, rs1565640081, rs1565635941, rs1565642765, rs1565647767, rs1565648547, rs1565648789, rs1565651223, rs1565651568, rs1565645563, rs1565647197, rs1565648656, rs794728627, rs1564500612, rs1565644366, rs1565646772, rs1349668409, rs1588862638, rs1483605155, rs1592630079, rs1592633378, rs1592633463, rs1592637081, rs1592637440, rs1592637455, rs1187634059, rs1592647398, rs1592648765, rs1592648830, rs1592649108, rs1592651767, rs1592657785, rs1592660101, rs1565652689, rs1592280948, rs1592280992, rs1592634740, rs1592649598, rs1592649615, rs1588873476, rs1592280833, rs1592658517, rs1592640181, rs1397494237, rs1592631908, rs1592636161, rs1592643178, rs1592649069, rs1592281087, rs755301027, rs1941501683, rs1941615895, rs1941625647, rs1941850919, rs1941861451, rs1941994887, rs1946487230, rs1946491613, rs1946492962, rs1941733228, rs1941598294, rs1064793168	19141585
Myelodysplastic syndrome	MYELODYSPLASTIC SYNDROME	rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587	17294728
Parathyroid adenoma	Parathyroid Adenoma	rs587776557
Pituitary adenoma	Pituitary growth hormone cell adenoma, ACTH-Secreting Pituitary Adenoma, Non-Functioning Pituitary Gland Neoplasm	rs5030861, rs104894194, rs121908356, rs121908347, rs727502931, rs121908348, rs121908349, rs111033271, rs121908351, rs121917839, rs121917840, rs587776681, rs193922688, rs121917841, rs587776682, rs587776683, rs121917842, rs121917843, rs121917844, rs121917845, rs11554273, rs121913495, rs121913494, rs137854533, rs140016178, rs397517323, rs397517327, rs397517329, rs397517341, rs397517342, rs183431253, rs397517350, rs370983472, rs397517367, rs794726693, rs727502919, rs766673446, rs786204663, rs1556379508, rs876657754, rs773464867, rs878853337, rs886037871, rs762529663, rs1057517027, rs1057517041, rs1057516832, rs1057517424, rs1057516846, rs1057524265, rs1060499789, rs750803248, rs1064797071, rs756147087, rs758382198, rs750880909, rs1554877806, rs769433759, rs1474524543, rs866435331, rs936479651, rs146918863, rs1554182514, rs1436089021, rs1554182507, rs1554182481, rs1554182645, rs1554182405, rs1554182632, rs747955135, rs745571683, rs1190307769, rs1564808024, rs1214465435, rs1589424694, rs1200012430, rs1377982927, rs1230303971, rs750027965, rs1292050472, rs1278603247, rs1862873659, rs1338446830, rs771766431, rs759981467, rs780917129, rs1221464948, rs1166948274, rs754876029, rs762805265

Unknown
Disease term	Disease name	Evidence	References	Source
Multiple Endocrine Neoplasia	multiple endocrine neoplasia			GenCC
Open Angle Glaucoma	glaucoma 1, open angle, E			GenCC
Diabetes	Diabetes			GWAS
Myocardial Infarction	Myocardial Infarction			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Coronary Heart Disease	Coronary Heart Disease			GWAS
Endometriosis	Endometriosis			GWAS
Intracranial Aneurysm	Intracranial Aneurysm			GWAS
Nasopharyngeal Carcinoma	Nasopharyngeal Carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.		GWAS, CBGDA
Heart Failure	Heart Failure			GWAS
Lymphocytic Leukemia	Lymphocytic Leukemia			GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.		GWAS, CBGDA
Carcinoma	Carcinoma			GWAS
Dermatitis	Dermatitis			GWAS
Hypertension	Hypertension			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Cerebral Aneurysm	Cerebral Aneurysm			GWAS
Ischemic Stroke	Ischemic Stroke			GWAS
Adenocarcinoma	Adenocarcinoma			GWAS
Multiple Sclerosis	Multiple Sclerosis			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS
Aortic Aneurysm	Aortic Aneurysm			GWAS
Subarachnoid hemorrhage	Subarachnoid hemorrhage			GWAS
Dental caries	Dental caries			GWAS
Astrocytoma	Astrocytoma			GWAS
Congestive Heart Failure	Congestive Heart Failure			GWAS
Fibromuscular Dysplasia	Fibromuscular Dysplasia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	31001805, 31208361
Adenocarcinoma of Lung	Associate	26069186, 27197191, 31775885, 34642306, 35253368, 37801862
Adenoma	Inhibit	25437056
Adenoma	Associate	28600574
Anemia Refractory	Associate	9269757
Anemia Refractory with Excess of Blasts	Associate	11167795, 9269757
Aneurysm	Associate	21775993
Anhedonia	Associate	17459456
Anodontia	Associate	36351537
Aortic Aneurysm	Inhibit	19343170
Aortic Aneurysm Abdominal	Associate	28214350
Aortic Arch Syndromes	Associate	27773886
Aortic Diseases	Associate	23315372
Arteriolosclerosis	Associate	24135527
Arthritis Rheumatoid	Associate	11167795
Astrocytoma	Associate	15367334, 15970925, 20730472, 26317630, 28699883, 28960623, 29564591, 29687258, 31177992, 32619305, 33077924, 33914057, 34355449, 35701666, 36031351, 36271929, 36725354, 37316586, 37550258
Astrocytoma	Inhibit	28181325
Ataxia Telangiectasia	Associate	23687089, 32345961, 7606004
Ataxia Telangiectasia	Inhibit	7994022
Atherosclerosis	Associate	21151960, 22706276, 24599170, 24680834, 30108282, 34241534, 36633253, 37117763, 38003316
Axial osteomalacia	Associate	25798827
Barrett Esophagus	Associate	31001805
Biliary Tract Neoplasms	Associate	12107841
Blast Crisis	Associate	15755284
Brain Ischemia	Associate	32293292
Brain Neoplasms	Associate	24968695, 26839018, 37572870, 40721593
Breast Neoplasms	Associate	22348646, 23544012, 24205493, 25927147, 26094658, 27102007, 28276595, 30457165, 33371806, 9990866
Burkitt Lymphoma	Associate	9473234
Calcinosis	Associate	27773886, 27905995
Calcinosis Cutis	Associate	32657779
Carcinogenesis	Associate	11676855, 15112341, 15221997, 17008550, 18507057, 20200803, 23504555, 7577470, 8698617
Carcinogenesis	Inhibit	32576587
Carcinoma	Associate	29615459, 29691299, 32879414, 34312479
Carcinoma Basal Cell	Associate	19578363
Carcinoma Hepatocellular	Associate	12937151, 15112341, 19818350, 22364296, 24254306, 24377595, 31040073, 31215439, 31646789, 33009370, 34921137, 36133439, 37781033
Carcinoma Merkel Cell	Associate	26981779
Carcinoma Non Small Cell Lung	Associate	23300840, 25501704, 26490983, 31775885, 35598205, 37572870
Carcinoma Pancreatic Ductal	Associate	27486979, 28007776, 35231699
Carcinoma Renal Cell	Associate	31034483, 31040073, 31208361, 33157048, 35764788, 36917021, 37479138
Carcinoma Squamous Cell	Associate	19047905, 23580324, 32500594, 36082904, 37316414, 37801862, 37821306
Carcinoma Squamous Cell	Stimulate	25674264
Carcinoma Squamous Cell	Inhibit	39222919
Carcinoma Transitional Cell	Inhibit	11720438
Cardiovascular Diseases	Associate	23134948, 30642433, 31804579, 32293292
Carotid Artery Diseases	Associate	27905995, 39319854
Cell Transformation Neoplastic	Associate	31305260
Cell Transformation Viral	Associate	11167795, 11849214, 9531610
Central Nervous System Infections	Associate	35701666
Cerebral Infarction	Associate	27773886, 27905995, 28716248, 28975602
Cerebral Small Vessel Diseases	Associate	28975602
Cerulean cataract	Associate	19338047
Cholangiocarcinoma	Associate	15467712, 29848569, 31040073, 35986087, 36335135, 39672383
Chondrosarcoma	Associate	36926116
Chordoma	Associate	18071362, 23019410, 37434245
Chromosome 2p16.1 P15 Deletion Syndrome	Associate	11874489
Chronic Disease	Associate	34607836
Colitis Ulcerative	Inhibit	31207308
Colorectal Neoplasms	Associate	14715079, 16369045, 24716938, 29986714, 31729423, 32271419, 37845622
Coronary Artery Disease	Inhibit	19343170
Coronary Artery Disease	Associate	21270820, 21307941, 21971053, 22706276, 22768093, 23091611, 23104008, 23199516, 23315372, 24573017, 24699314, 25185447, 25592106, 30587704, 30921371, 32293292, 34241534, 34607836, 34961328
Coronary Artery Disease Autosomal Dominant 1	Associate	22216278
Coronary Disease	Associate	18340101, 18599554, 21347282, 22768093, 24736300, 31014396
Crohn Disease	Associate	37543814
Cushing's symphalangism	Associate	32293292
Dementia	Associate	30642433
Dental Plaque	Associate	39319854
Depressive Disorder	Associate	29280852
Dermatofibrosarcoma	Associate	35441365
Diabetes Mellitus	Associate	17463249, 18544707, 19008344, 19214202, 20386740, 27486979, 30108282, 30457165
Diabetes Mellitus Type 1	Associate	31299986
Diabetes Mellitus Type 2	Associate	17463248, 17463249, 18368387, 18426861, 18469204, 18633108, 18694974, 19008344, 19033397, 19228808, 19324937, 19401414, 19862325, 20142250, 20161779, 20509872, 21775993, 22293688, 22961080, 23104008, 23134948, 23193118, 23382687, 23670970, 24013783, 24376643, 25273842, 25430018, 25587982, 26139146, 26542317, 27377502, 29280852, 29432124, 30108282, 33203726, 33972266, 34607836, 37364045
Diffuse Intrinsic Pontine Glioma	Associate	21138945
Disease	Associate	9116295
Dissection Thoracic Aorta	Associate	30066903
Dysbiosis	Associate	37543814
Embolism Fat	Associate	24680834
Endometrial Neoplasms	Associate	23361049, 31040073, 35854199, 35937391, 36525280, 37890416
Endometriosis	Associate	25154675, 30010178
Epstein Barr Virus Infections	Associate	28581676
Esophageal Neoplasms	Associate	23361049, 29771415
Esophageal Squamous Cell Carcinoma	Associate	24794927, 25239644, 27960044
Familial cylindromatosis	Associate	8752837
Fatty Liver	Associate	24680834
Fibromuscular Dysplasia	Associate	38459180
Fibrosis	Associate	29420051
Ganglioglioma	Associate	18371186, 34355449
Gastrointestinal Stromal Tumors	Associate	15929122
GATA2 Deficiency	Associate	11676855, 12823347
Genital Neoplasms Female	Associate	9159345
Glaucoma	Associate	22428042, 23111177, 27367510, 33114701
Glaucoma Open Angle	Associate	21398277, 22428042, 22605921, 22761751, 23111177, 23963167, 25242315, 25414181, 25798827, 27367510, 29049738, 29104244, 29261660, 29452408, 30255811, 32476818, 32492046, 32825664
Glioblastoma	Associate	17493032, 19435819, 21203894, 21713760, 21884817, 23663786, 26839018, 28201779, 29105198, 32687679, 33009979, 33077924, 33692446, 33876327, 34997451, 35815721, 36055049, 7887443
Glioblastoma	Inhibit	34496929
Glioma	Associate	19578366, 19578367, 20462933, 20847058, 21203894, 21356187, 21470325, 21742680, 21920947, 23115063, 23161787, 26839018, 27780202, 30558563, 31428092, 33009979, 34076984, 34153138, 34496929, 34556140, 35103816, 36031351, 36571817, 36648487, 37032198, 37524847, 37574201, 37910594, 7887443, 8878451
Glioma	Inhibit	7775255
Granulosa Cell Tumor	Associate	32203090
Head and Neck Neoplasms	Associate	27377733
Hemangioendothelioma Epithelioid	Associate	31577358
Hematologic Neoplasms	Associate	10498617, 12213729, 28052659
Hepatitis B	Associate	24254306
Hepatitis E	Associate	33009979
Hereditary Breast and Ovarian Cancer Syndrome	Associate	37706649
Histiocytoma Angiomatoid Fibrous	Associate	35347249
HIV Infections	Associate	28830571
Hodgkin Disease	Associate	12213729
Hyperparathyroidism	Associate	37810884
Hypertension	Associate	23963167
Hypoglycemia	Associate	18633108
Idiopathic Pulmonary Fibrosis	Inhibit	29420051
Idiopathic Pulmonary Fibrosis	Associate	29420051
Inflammation	Associate	22768093, 26114387, 37579157
Inflammatory Bowel Diseases	Inhibit	31207308
Intestinal Neoplasms	Associate	37845622
Intracranial Aneurysm	Associate	20364137, 22776031, 30994044, 31250579
Keratosis	Associate	18163473
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	15650057
Kotzot Richter syndrome	Associate	31467127
Lead Poisoning Nervous System	Inhibit	36915153
Leprosy Lepromatous	Associate	22144494
Leukemia	Associate	10498617, 10812241, 15015578, 18523155, 21114827, 24443786, 24528084, 29364483, 7994022, 9269757, 9531610
Leukemia	Inhibit	7795238
Leukemia Biphenotypic Acute	Associate	10706859, 11380466, 12028019, 26868379
Leukemia Lymphocytic Chronic B Cell	Associate	17546638, 31467127, 9375748
Leukemia Lymphocytic Chronic B Cell	Inhibit	7795238
Leukemia Lymphoid	Associate	12228235
Leukemia Lymphoma Adult T Cell	Associate	10378889
Leukemia Lymphoma Adult T Cell	Inhibit	7742529
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10779450, 19338047, 24528084, 24938701, 25387678
Leukemia Myeloid	Associate	18519632
Leukemia Myeloid Acute	Associate	10498617, 10706859, 11222358, 11313277, 12648079, 17258075, 18523155, 19211935, 19338047, 19546476, 20190193, 23468979, 24164743, 26387756, 9531610
Leukemia Myeloid Acute	Inhibit	7544647
Leukemia Myelomonocytic Juvenile	Stimulate	19338047
Leukemia Myelomonocytic Juvenile	Associate	21406719
Leukemia Plasma Cell	Associate	9012694
Leukemia Prolymphocytic T Cell	Associate	16565223, 20974048
Leukemia Promyelocytic Acute	Associate	12899712, 28052659
Leukemia T Cell	Inhibit	9422538
Leukocytosis	Associate	28052659
Leukoplakia Oral	Associate	18163473
Liver Failure	Associate	19664251
Low Tension Glaucoma	Associate	27367510
Lung Neoplasms	Associate	30642433, 31775885
Lymphatic Metastasis	Stimulate	31960744
Lymphatic Metastasis	Associate	37314514
Lymphoma	Associate	10848787, 12213729, 16369970, 35142151, 36402300, 38460675, 7632961, 8652807, 8698617, 9616165
Lymphoma B Cell	Associate	10477703, 26599546
Lymphoma B Cell	Inhibit	12060387
Lymphoma B Cell Marginal Zone	Associate	36995085
Lymphoma Follicular	Associate	24388756, 27750045, 30446494
Lymphoma Large B Cell Diffuse	Associate	21504712, 24815848, 37706649, 9616165
Lymphoma Large Cell Anaplastic	Associate	12213729
Lymphoma Mantle Cell	Associate	20427703, 37605345
Lymphoma Non Hodgkin	Associate	10848787, 11874489, 12213729, 19383911, 7544647, 7632961, 9616165
Lymphoma Primary Cutaneous Anaplastic Large Cell	Inhibit	20118908
Lymphoma T Cell	Associate	10477703
Lymphoma T Cell Cutaneous	Inhibit	20118908
Lymphoma T Cell Peripheral	Associate	30782609
Melanoma	Associate	11104570, 11874489, 12875987, 15526363, 15819981, 20140953, 21477078, 22549727, 24616037, 24884915, 27855847, 28699883, 30666677, 32067956, 34607836
Melanoma astrocytoma syndrome	Associate	24884915, 28699883
Meningeal Neoplasms	Associate	37548547
Meningioma	Associate	11485924, 25648363, 25993161, 33087175, 37093270
Mesothelioma	Associate	36901697, 37295554
Mesothelioma Malignant	Associate	34648949
Metabolic Syndrome	Associate	38193570
Metrorrhagia	Associate	32835660
Monoclonal Gammopathy of Undetermined Significance	Associate	11418489
Mouth Neoplasms	Associate	27749845
Moyamoya disease 1	Associate	30994044
Multiple Endocrine Neoplasia Type 1	Associate	19141585, 20616437
Multiple Myeloma	Associate	11418489, 36043519, 9012694, 9116295, 9792305
Mycosis Fungoides	Associate	11850526, 11874489
Mycosis Fungoides	Inhibit	20118908
Myelodysplastic Syndromes	Associate	11167795, 11435325, 12351408, 12648079, 15755284, 17258075, 18316853, 23320102, 26025663, 28539603, 9269757, 9531610
Myelodysplastic Syndromes	Inhibit	21286011
Myeloproliferative Disorders	Associate	19338047
Myocardial Infarction	Associate	21775993, 22776031, 30587704, 31804579, 34607836
Nasopharyngeal Carcinoma	Associate	24751144, 30950204, 37257705
Nasopharyngeal Carcinoma	Stimulate	37352861
Nemaline myopathy 5	Inhibit	11720438
Neoplasm Metastasis	Associate	24968695, 30774116, 32657779, 36906070, 37591896, 37634866, 37897649, 8826861
Neoplasm Metastasis	Inhibit	28396463, 37572870
Neoplasms	Inhibit	10734227, 10998150, 11485924, 11779840, 12060387, 12460470, 12548606, 12875987, 15467712, 15517085, 15590562, 15970925, 16783165, 16989737, 17258075, 17316622, 17485517, 17546638, 17977648, 18055295, 18163473, 18332116, 18332873, 18625718, 18712977, 18940470, 19343170, 20190193, 20200803, 21151960, 21504712, 21599969, 21713760, 22549727, 22560925, 22815924, 22839576, 23101500, 23212831, 23464438, 24205493, 24252461, 24377595, 24616037, 24680834, 24716938, 24875940, 25015188, 25387678, 25663546, 26387756, 26872600, 26909863, 27385346, 28344356, 28396463, 28481918, 28600574, 30666677, 30782609, 30926883, 32067956, 32209730, 33619226, 34312479, 34940123, 36633253, 36821179, 36866403, 36966552, 36973285, 37774699, 7604019, 7606004, 7632961, 7742529, 7994022, 8652807, 8752837, 8790415, 8878451, 9159345, 9269757, 9375748, 9422538, 9473234, 9792305, 9846966
Neoplasms	Associate	10812241, 10848787, 11222358, 11676855, 11720438, 12213729, 12351408, 12823347, 15160522, 15221997, 15305192, 15507675, 15929122, 15942635, 17459456, 17493032, 17533400, 18071362, 18507057, 18519632, 19350087, 19818350, 20140953, 20671427, 20730472, 21138945, 21151178, 21151896, 21638518, 21760961, 21775993, 23018873, 23161787, 23412337, 23504555, 23661397, 24767714, 25239644, 25648363, 25695927, 25712460, 26317630, 26799422, 27197191, 27465101, 27486979, 27749845, 27750214, 28201779, 28699883, 29654067, 29981927, 29995020, 30108282, 30635552, 30774116, 31040073, 31189690, 31646789, 31690770, 31954095, 32183138, 32689909, 32721124, 32885893, 33087175, 33149122, 33262201, 33270827, 33472910, 33963205, 34127009, 34355449, 34496929, 34556140, 34618539, 35170141, 35176183, 35441365, 35764788, 36055049, 36082904, 36167400, 36271929, 36571817, 36604730, 36941772, 37138345, 37316586, 37511614, 37548547, 37634866, 37673211, 37845622, 8698617, 9000591, 9378820
Neoplasms	Stimulate	17632454
Neoplasms Radiation Induced	Inhibit	34545083
Neoplasms Squamous Cell	Associate	21900200, 25674264, 31960744, 33687433
Nerve Degeneration	Associate	23111177
Neurilemmoma	Associate	18551412
Neuroblastoma	Associate	15305192, 36941772
Neuroectodermal Tumors Primitive	Associate	21798848, 28008994
Neurofibroma	Associate	36866403
Nevus	Associate	27855847, 30666677
Nevus Epithelioid and Spindle Cell	Associate	30666677
Nevus Pigmented	Stimulate	27855847
Obesity	Associate	18469204, 24680834, 33203726
Oligodendroglioma	Associate	37574201
Oncogene Addiction	Associate	25674264
Osteoarthritis	Associate	36915153
Osteoporosis	Associate	37117763
Osteosarcoma	Associate	30774116
Ovarian Diseases	Associate	36622742
Ovarian Diseases	Inhibit	9159345
Ovarian Neoplasms	Associate	10077528, 16928264, 19258477, 24448499
Pancreatic Neoplasms	Inhibit	22293850
Pancreatic Neoplasms	Associate	23893923, 24534469, 27486979, 28396463, 35345349
Papilledema	Associate	29261660
Papilloma Inverted	Associate	17673925
Parathyroid Neoplasms	Associate	21638518, 23715670, 28600574
Paroxysmal Extreme Pain Disorder	Associate	36613555
Peripheral Arterial Disease	Associate	34601942
Peritonitis	Inhibit	36138075
Peritonitis	Associate	37453150
Personality Disorders	Associate	21900200
Philadelphia Chromosome	Associate	12586619, 30190342
Pinealoma	Associate	21798848
Plaque Atherosclerotic	Associate	22706276, 39319854
Plasmacytoma	Associate	9116295
Pleural Effusion Malignant	Associate	18055295
Polycystic Ovary Syndrome	Associate	36622742
Post Infectious Disorders	Inhibit	31243333
Postoperative Hemorrhage	Associate	37548547
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	28481918, 30874617
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10090949, 10706859, 12036898, 14666292, 17008550, 20435627, 20617153, 21592569, 23508010, 26333125, 27750045, 28481918, 30041662, 30190342, 30635552, 30874617, 33369444, 37314514, 7606004, 7780130, 7994022
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	7727766
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11167795, 11260073, 11380466, 12648079, 15724842, 16281935, 23320102, 32345961, 36270471, 7606004, 8630377, 9233578, 9446664
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	26206799
Primary Myelofibrosis	Associate	11849214
Prostatic Neoplasms	Associate	16799475, 18670647, 23193118, 23342268, 27197191, 33522043, 34667276, 7573365
Pulmonary Fibrosis	Associate	29420051
Respiratory Tract Infections	Associate	26278805
Retinal Dysplasia	Associate	18163473, 31001805
Rhabdoid Tumor	Inhibit	18332116
Rhabdomyosarcoma	Associate	36941772, 36966552
Salivary Gland Neoplasms	Associate	26247885
Sarcoma	Associate	33963205
Sezary Syndrome	Associate	11874489, 20118908
Sick Sinus Syndrome	Associate	33963001
Sleep Disorders Circadian Rhythm	Associate	29848569
Smoke Inhalation Injury	Stimulate	15221997
Squamous Cell Carcinoma of Head and Neck	Associate	15221997, 19430297, 27377733, 39432990, 9378820
Stomach Diseases	Associate	37845622
Stomach Neoplasms	Associate	15609398, 18507057, 21060834, 23504555, 26334618, 26799422, 29089060, 30567531, 31308508, 31665700, 31814518, 37845622, 8797888
Stroke	Associate	19343170
Teratoma	Associate	31305260
Thymic epithelial tumor	Associate	37703595
Thymoma	Associate	37703595, 37749819
Thyroid Carcinoma Anaplastic	Associate	29615459
Thyroid Neoplasms	Associate	27507052
Thyroid Neoplasms	Stimulate	35432631
Translocation Genetic	Associate	37417617
Triple Negative Breast Neoplasms	Associate	30060056
Uniparental Disomy	Associate	37801862
Urinary Bladder Neoplasms	Associate	11720438, 15507675, 21599969, 27270441, 27750214, 36462464, 7577470
Urinary Bladder Neoplasms	Inhibit	15590562
Uterine Cervical Dysplasia	Stimulate	25674264
Uterine Cervicitis	Associate	9159345
Uterine Diseases	Associate	9159345
Vascular Calcification	Associate	27905995
Vascular Diseases	Associate	22776031, 38459180
Vasculitis Leukocytoclastic Cutaneous	Associate	18712977, 23464438
Vulvar Neoplasms	Inhibit	23580324, 9159345