CDKN2B (cyclin dependent kinase inhibitor 2B)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1030
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin dependent kinase inhibitor 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDKN2B
Synonyms (NCBI Gene) Gene synonyms aliases
CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the ac
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(65)
miRTarBase ID miRNA Experiments Reference
MIRT016027 hsa-miR-374b-5p Sequencing 20371350
MIRT019955 hsa-miR-375 Microarray 20215506
MIRT027714 hsa-miR-98-5p Microarray 19088304
MIRT704749 hsa-miR-3617-5p HITS-CLIP 23313552
MIRT704748 hsa-miR-641 HITS-CLIP 23313552
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
Transcription factor Regulation Reference
BCL6 Repression 22723377
DNMT1 Unknown 19545050
EP300 Unknown 19419955;22000024
EZH2 Repression 21697275
FOXO3 Unknown 19419955
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
GO ID Ontology Definition Evidence Reference
GO:0004861 Function Cyclin-dependent protein serine/threonine kinase inhibitor activity IBA
GO:0004861 Function Cyclin-dependent protein serine/threonine kinase inhibitor activity IDA 8078588
GO:0004861 Function Cyclin-dependent protein serine/threonine kinase inhibitor activity IEA
GO:0004861 Function Cyclin-dependent protein serine/threonine kinase inhibitor activity NAS 9230210
GO:0005515 Function Protein binding IPI 16169070, 16189514, 19447967, 21900206, 23455922, 23602568, 24981860, 25416956, 25910212, 26496610, 28514442, 31515488, 32296183, 32707033, 33961781, 35512704
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600431 1788 ENSG00000147883
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P42772
Protein name Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B)
Protein function Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines. {ECO:0000269|PubMed:9230210}.
Sequence 
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD
Sequence length 138
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  FoxO signaling pathway
Cell cycle
Cellular senescence
TGF-beta signaling pathway
Cushing syndrome
Human T-cell leukemia virus 1 infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Gastric cancer 		  SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
Cyclin D associated events in G1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (34)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Adenocarcinoma Adenocarcinoma N/A N/A GWAS
Aortic Aneurysm Aortic aneurysm N/A N/A GWAS
Astrocytoma Astrocytoma, Pilocytic astrocytoma N/A N/A GWAS
Breast cancer Breast cancer, Breast cancer (estrogen-receptor negative) N/A N/A GWAS
Show/Hide Text Mining Associations (261)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 31001805, 31208361
Adenocarcinoma of Lung Associate 26069186, 27197191, 31775885, 34642306, 35253368, 37801862
Adenoma Inhibit 25437056
Adenoma Associate 28600574
Anemia Refractory Associate 9269757
Anemia Refractory with Excess of Blasts Associate 11167795, 9269757
Aneurysm Associate 21775993
Anhedonia Associate 17459456
Anodontia Associate 36351537
Aortic Aneurysm Inhibit 19343170