Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10296
Gene name Gene Name - the full gene name approved by the HGNC.	Macrophage erythroblast attacher, E3 ubiquitin ligase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAEA
Synonyms (NCBI Gene) Gene synonyms aliases	EMLP, EMP, GID9, HLC-10, P44EMLP, PIG5
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturation and enucleation of erythroblasts, presumably by suppressing apoptosis. The encoded protein is an integral membrane prote

Show/Hide all(102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037862	hsa-miR-455-3p	CLASH	23622248
MIRT1125161	hsa-miR-181a	CLIP-seq
MIRT1125162	hsa-miR-181b	CLIP-seq
MIRT1125163	hsa-miR-181c	CLIP-seq
MIRT1125164	hsa-miR-181d	CLIP-seq
MIRT1125165	hsa-miR-3689a-5p	CLIP-seq
MIRT1125166	hsa-miR-3689b	CLIP-seq
MIRT1125167	hsa-miR-3689e	CLIP-seq
MIRT1125168	hsa-miR-3689f	CLIP-seq
MIRT1125169	hsa-miR-4262	CLIP-seq
MIRT1125170	hsa-miR-4455	CLIP-seq
MIRT1125171	hsa-miR-516a-5p	CLIP-seq
MIRT1125172	hsa-miR-524-3p	CLIP-seq
MIRT1125173	hsa-miR-525-3p	CLIP-seq
MIRT1125174	hsa-miR-1178	CLIP-seq
MIRT1125175	hsa-miR-1236	CLIP-seq
MIRT1125176	hsa-miR-1290	CLIP-seq
MIRT1125177	hsa-miR-1297	CLIP-seq
MIRT1125178	hsa-miR-1305	CLIP-seq
MIRT1125179	hsa-miR-133a	CLIP-seq
MIRT1125180	hsa-miR-133b	CLIP-seq
MIRT1125161	hsa-miR-181a	CLIP-seq
MIRT1125162	hsa-miR-181b	CLIP-seq
MIRT1125163	hsa-miR-181c	CLIP-seq
MIRT1125164	hsa-miR-181d	CLIP-seq
MIRT1125181	hsa-miR-26a	CLIP-seq
MIRT1125182	hsa-miR-26b	CLIP-seq
MIRT1125183	hsa-miR-3167	CLIP-seq
MIRT1125165	hsa-miR-3689a-5p	CLIP-seq
MIRT1125166	hsa-miR-3689b	CLIP-seq
MIRT1125167	hsa-miR-3689e	CLIP-seq
MIRT1125168	hsa-miR-3689f	CLIP-seq
MIRT1125184	hsa-miR-3692	CLIP-seq
MIRT1125169	hsa-miR-4262	CLIP-seq
MIRT1125185	hsa-miR-4307	CLIP-seq
MIRT1125170	hsa-miR-4455	CLIP-seq
MIRT1125186	hsa-miR-4465	CLIP-seq
MIRT1125187	hsa-miR-4768-5p	CLIP-seq
MIRT1125188	hsa-miR-4789-5p	CLIP-seq
MIRT1125189	hsa-miR-496	CLIP-seq
MIRT1125190	hsa-miR-498	CLIP-seq
MIRT1125171	hsa-miR-516a-5p	CLIP-seq
MIRT1125172	hsa-miR-524-3p	CLIP-seq
MIRT1125173	hsa-miR-525-3p	CLIP-seq
MIRT1125191	hsa-miR-876-5p	CLIP-seq
MIRT1125192	hsa-miR-9	CLIP-seq
MIRT1551017	hsa-miR-579	CLIP-seq
MIRT1551018	hsa-miR-876-3p	CLIP-seq
MIRT2035297	hsa-miR-105	CLIP-seq
MIRT2035298	hsa-miR-1252	CLIP-seq
MIRT1125177	hsa-miR-1297	CLIP-seq
MIRT1125178	hsa-miR-1305	CLIP-seq
MIRT2035299	hsa-miR-1910	CLIP-seq
MIRT1125181	hsa-miR-26a	CLIP-seq
MIRT1125182	hsa-miR-26b	CLIP-seq
MIRT2035300	hsa-miR-3682-5p	CLIP-seq
MIRT2035301	hsa-miR-3942-3p	CLIP-seq
MIRT1125185	hsa-miR-4307	CLIP-seq
MIRT1125186	hsa-miR-4465	CLIP-seq
MIRT2035302	hsa-miR-4738-3p	CLIP-seq
MIRT1125190	hsa-miR-498	CLIP-seq
MIRT2035303	hsa-miR-522	CLIP-seq
MIRT2035304	hsa-miR-548k	CLIP-seq
MIRT2035305	hsa-miR-570	CLIP-seq
MIRT2265815	hsa-miR-1283	CLIP-seq
MIRT2265816	hsa-miR-2117	CLIP-seq
MIRT1125165	hsa-miR-3689a-5p	CLIP-seq
MIRT1125166	hsa-miR-3689b	CLIP-seq
MIRT1125167	hsa-miR-3689e	CLIP-seq
MIRT1125168	hsa-miR-3689f	CLIP-seq
MIRT1125170	hsa-miR-4455	CLIP-seq
MIRT1551017	hsa-miR-579	CLIP-seq
MIRT2265817	hsa-miR-606	CLIP-seq
MIRT1551018	hsa-miR-876-3p	CLIP-seq
MIRT2390446	hsa-miR-3665	CLIP-seq
MIRT2390447	hsa-miR-657	CLIP-seq
MIRT2035298	hsa-miR-1252	CLIP-seq
MIRT2565171	hsa-miR-1972	CLIP-seq
MIRT2565172	hsa-miR-27a	CLIP-seq
MIRT2565173	hsa-miR-27b	CLIP-seq
MIRT2565174	hsa-miR-3691-3p	CLIP-seq
MIRT2565175	hsa-miR-3918	CLIP-seq
MIRT2565176	hsa-miR-4685-5p	CLIP-seq
MIRT2565177	hsa-miR-4707-5p	CLIP-seq
MIRT2565178	hsa-miR-4715-3p	CLIP-seq
MIRT2565179	hsa-miR-4755-3p	CLIP-seq
MIRT2565180	hsa-miR-4795-5p	CLIP-seq
MIRT2565181	hsa-miR-513a-5p	CLIP-seq
MIRT2565182	hsa-miR-515-5p	CLIP-seq
MIRT2035298	hsa-miR-1252	CLIP-seq
MIRT2565171	hsa-miR-1972	CLIP-seq
MIRT2565172	hsa-miR-27a	CLIP-seq
MIRT2565173	hsa-miR-27b	CLIP-seq
MIRT2565174	hsa-miR-3691-3p	CLIP-seq
MIRT2565175	hsa-miR-3918	CLIP-seq
MIRT2565176	hsa-miR-4685-5p	CLIP-seq
MIRT2565177	hsa-miR-4707-5p	CLIP-seq
MIRT2565178	hsa-miR-4715-3p	CLIP-seq
MIRT2565179	hsa-miR-4755-3p	CLIP-seq
MIRT2565180	hsa-miR-4795-5p	CLIP-seq
MIRT2565181	hsa-miR-513a-5p	CLIP-seq
MIRT2565182	hsa-miR-515-5p	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	29911972
GO:0003779	Function	Actin binding	IDA	16510120
GO:0003779	Function	Actin binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17467196, 29911972
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	24143168
GO:0005654	Component	Nucleoplasm	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	16510120
GO:0005826	Component	Actomyosin contractile ring	IDA	16510120
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	16510120
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	9763581
GO:0005886	Component	Plasma membrane	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007155	Process	Cell adhesion	IDA	9763581
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	16510120
GO:0008270	Function	Zinc ion binding	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IDA	16510120
GO:0016363	Component	Nuclear matrix	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IDA	9763581
GO:0034657	Component	GID complex	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0048822	Process	Enucleate erythrocyte development	IEA
GO:0051301	Process	Cell division	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
606801	13731	ENSG00000090316

Protein

UniProt ID

Q7L5Y9

Protein name

E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Cell proliferation-inducing gene 5 protein) (Erythroblast macrophage protein) (Human lung cancer oncogene 10 protein) (HLC-10) (Macrophage erythroblast attacher) (P44EMLP)

Protein function

Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required f

PDB

8PJN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10607	CLTH	159 → 301	CTLH/CRA C-terminal to LisH motif domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected at macrophage membranes (at protein level). Ubiquitous. {ECO:0000269|PubMed:9763581}.

Sequence

MAVQESAAQLSMTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSG
CPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVW
KRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLA
WCHDNKSRLRKMKSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQAM
GMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQLGNNSVFTLTLQAGLSAIKTP
QCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGY
VYGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM

Sequence length

396

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bone Diseases Metabolic	Associate	33423677
Carcinoma Pancreatic Ductal	Associate	33820913
Diabetes Mellitus Type 2	Associate	24086726, 27175665
Endocarditis	Associate	30686615
Extravasation of Diagnostic and Therapeutic Materials	Associate	34260518
Inflammation	Associate	23550836
Insulin Resistance	Associate	32260174
Osteoporosis	Associate	33423677
Pulmonary Disease Chronic Obstructive	Associate	23550836

MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)