Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10283
Gene name Gene Name - the full gene name approved by the HGNC.
CWC27 spliceosome associated cyclophilin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CWC27
Synonyms (NCBI Gene) Gene synonyms aliases
NY-CO-10, RPSKA, SDCCAG-10, SDCCAG10
Disease Acronyms (UniProt) Disease acronyms from UniProt database
RPSKA
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q12.3
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs752159903 A>-,AA Pathogenic Frameshift variant, genic downstream transcript variant, coding sequence variant
rs781702398 C>A Pathogenic Coding sequence variant, stop gained
rs1085307446 G>A Pathogenic Synonymous variant, coding sequence variant
rs1085307447 G>T Pathogenic Genic downstream transcript variant, stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030476 hsa-miR-24-3p Microarray 19748357
MIRT445334 hsa-miR-548c-3p PAR-CLIP 22100165
MIRT445333 hsa-miR-3163 PAR-CLIP 22100165
MIRT445332 hsa-miR-4635 PAR-CLIP 22100165
MIRT445331 hsa-miR-340-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638, 29360106
GO:0000398 Process MRNA splicing, via spliceosome TAS
GO:0000413 Process Protein peptidyl-prolyl isomerization IBA 21873635
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IDA 20676357
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617170 10664 ENSG00000153015
Protein
UniProt ID Q6UX04
Protein name Spliceosome-associated protein CWC27 homolog (Antigen NY-CO-10) (Probable inactive peptidyl-prolyl cis-trans isomerase CWC27 homolog) (PPIase CWC27) (Serologically defined colon cancer antigen 10)
Protein function As part of the spliceosome, plays a role in pre-mRNA splicing (PubMed:29360106). Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity (PubMed:20676357). As a component of the minor spliceosome, involved in the splicing o
PDB 2HQ6 , 4R3E , 5Z56 , 5Z58 , 6FF4 , 6FF7 , 6YVH , 7DVQ , 8I0R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00160 Pro_isomerase 14 166 Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Domain
Sequence
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPG
FIVQGGDPTGTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRA
DELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEV
LFNPFDDIIPREIK
RLKKEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNLMRERIAKKLKKDTSANVKSA
GEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEEAPPDGAVAEY
RREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWM
SHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR
Sequence length 472
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    mRNA Splicing - Major Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Macrocephaly Macrocephaly rs786204854, rs764333096, rs1557739557
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Metaphyseal chondrodysplasia Metaphyseal chondrodysplasia rs121909500, rs121434597, rs121434598, rs121434600, rs121434602, rs199476103, rs727502774, rs1554651507, rs727502776, rs1554651446, rs727502778, rs1554651469, rs878853178, rs796065036, rs111033544
View all (92 more)
Unknown
Disease term Disease name Evidence References Source
Metaphyseal Chondrodysplasia metaphyseal chondrodysplasia-retinitis pigmentosa syndrome GenCC
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Schizophrenia Schizophrenia GWAS
Diverticulitis Diverticulitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 36039594
Cognition Disorders Associate 36039594
Developmental Defects of Enamel Associate 32329775
Hemangioblastoma Associate 28742274
Immunologic Deficiency Syndromes Associate 32329775
Metaphyseal Chondrodysplasia with Retinitis Pigmentosa Associate 38134094
Mitochondrial Diseases Associate 36039594
Neuroinflammatory Diseases Associate 36039594
Refsum Disease Infantile Associate 34828430
Retinal Degeneration Associate 32329775