Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10276
Gene name Gene Name - the full gene name approved by the HGNC.
Neuroepithelial cell transforming 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NET1
Synonyms (NCBI Gene) Gene synonyms aliases
ARHGEF8, NET1A
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is part of the family of Rho guanine nucleotide exchange factors. Members of this family activate Rho proteins by catalyzing the exchange of GDP for GTP. The protein encoded by this gene interacts with RhoA within the cell nucleus and may play a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019642 hsa-miR-340-5p Sequencing 20371350
MIRT029990 hsa-miR-26b-5p Microarray 19088304
MIRT030610 hsa-miR-24-3p Microarray 19748357
MIRT044778 hsa-miR-320a CLASH 23622248
MIRT438530 hsa-miR-22-3p Luciferase reporter assay, qRT-PCR, Western blot 25041463
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 8649828
GO:0005515 Function Protein binding IPI 24550280, 30126976, 32296183
GO:0005634 Component Nucleus IEA
GO:0005829 Component Cytosol TAS
GO:0007165 Process Signal transduction TAS 8649828
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606450 14592 ENSG00000173848
Protein
UniProt ID Q7Z628
Protein name Neuroepithelial cell-transforming gene 1 protein (Proto-oncogene p65 Net1) (Rho guanine nucleotide exchange factor 8)
Protein function Acts as a guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death. {ECO:0000269|PubMed:2
PDB 3EO2 , 4XH9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00621 RhoGEF 178 354 RhoGEF domain Domain
PF00169 PH 375 501 PH domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:8649828}.
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDIN
LKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHT
LQANDVFHKQQWFNCIRAAIA
PFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRAST
VSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV
Sequence length 596
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NRAGE signals death through JNK
Rho GTPase cycle
G alpha (12/13) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32420320
Attention Deficit Disorder with Hyperactivity Associate 20039948
Barrett Esophagus Stimulate 23945136
Breast Neoplasms Associate 19124484, 23380069, 23689132, 24897521, 30332929
Carcinoma Hepatocellular Associate 20590388, 24885292, 27216880, 31128017, 32641699, 36458010
Carcinoma Non Small Cell Lung Associate 32420320
Leukemia Myelogenous Chronic BCR ABL Positive Associate 25041463
Lung Neoplasms Associate 32420320, 33955315
Neoplasm Metastasis Associate 19124484, 20590388, 30332929
Neoplasms Associate 18827818, 20590388, 23689132, 23945136, 30332929, 31046876, 32420320, 34957935