Gene Gene information from NCBI Gene database.
Entrez ID 10276
Gene name Neuroepithelial cell transforming 1
Gene symbol NET1
Synonyms (NCBI Gene)
ARHGEF8NET1A
Chromosome 10
Chromosome location 10p15.1
Summary This gene is part of the family of Rho guanine nucleotide exchange factors. Members of this family activate Rho proteins by catalyzing the exchange of GDP for GTP. The protein encoded by this gene interacts with RhoA within the cell nucleus and may play a
miRNA miRNA information provided by mirtarbase database.
366
miRTarBase ID miRNA Experiments Reference
MIRT019642 hsa-miR-340-5p Sequencing 20371350
MIRT029990 hsa-miR-26b-5p Microarray 19088304
MIRT030610 hsa-miR-24-3p Microarray 19748357
MIRT044778 hsa-miR-320a CLASH 23622248
MIRT438530 hsa-miR-22-3p Luciferase reporter assayqRT-PCRWestern blot 25041463
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 8649828
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity TAS 8649828
GO:0005515 Function Protein binding IPI 24550280, 30126976, 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606450 14592 ENSG00000173848
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z628
Protein name Neuroepithelial cell-transforming gene 1 protein (Proto-oncogene p65 Net1) (Rho guanine nucleotide exchange factor 8)
Protein function Acts as a guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death. {ECO:0000269|PubMed:2
PDB 3EO2 , 4XH9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00621 RhoGEF 178 354 RhoGEF domain Domain
PF00169 PH 375 501 PH domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:8649828}.
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDIN
LKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHT
LQANDVFHKQQWFNCIRAAIA
PFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRAST
VSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV
Sequence length 596
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NRAGE signals death through JNK
Rho GTPase cycle
G alpha (12/13) signalling events
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Benign rs78693452 RCV005906009
Ependymoma Uncertain significance rs1554818513 RCV000577843
Gastric cancer Uncertain significance rs199808307 RCV005939336
Long QT syndrome Likely benign rs796052153 RCV000190140
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32420320
Attention Deficit Disorder with Hyperactivity Associate 20039948
Barrett Esophagus Stimulate 23945136
Breast Neoplasms Associate 19124484, 23380069, 23689132, 24897521, 30332929
Carcinoma Hepatocellular Associate 20590388, 24885292, 27216880, 31128017, 32641699, 36458010
Carcinoma Non Small Cell Lung Associate 32420320
Leukemia Myelogenous Chronic BCR ABL Positive Associate 25041463
Lung Neoplasms Associate 32420320, 33955315
Neoplasm Metastasis Associate 19124484, 20590388, 30332929
Neoplasms Associate 18827818, 20590388, 23689132, 23945136, 30332929, 31046876, 32420320, 34957935