Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10270
Gene name Gene Name - the full gene name approved by the HGNC.
A-kinase anchoring protein 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AKAP8
Synonyms (NCBI Gene) Gene synonyms aliases
AKAP 95, AKAP-8, AKAP-95, AKAP95
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001654 hsa-let-7b-5p pSILAC 18668040
MIRT024227 hsa-miR-218-5p Sequencing 20371350
MIRT032126 hsa-let-7d-5p Sequencing 20371350
MIRT001654 hsa-let-7b-5p Proteomics;Other 18668040
MIRT040654 hsa-miR-92b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle TAS 9473338
GO:0000793 Component Condensed chromosome IEA
GO:0001939 Component Female pronucleus IEA
GO:0002376 Process Immune system process IEA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604692 378 ENSG00000105127
Protein
UniProt ID O43823
Protein name A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95)
Protein function Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II) (PubMed:9473338). Acts as an anchor for a PKA-signaling complex onto mitotic chromosomes, which is required for maintenance of chromo
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04988 AKAP95 415 546 A-kinase anchoring protein 95 (AKAP95) Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. Expressed in mature dendritic cells. {ECO:0000269|PubMed:19277197}.
Sequence
MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPF
TSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE
Sequence length 692
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autistic Disorder Associate 26076356
Breast Neoplasms Associate 28755423, 32321829
Cleft Lip Associate 26913922
Colorectal Neoplasms Associate 36691407
Esophageal Neoplasms Associate 28771997
Lung Neoplasms Associate 26880274, 32338437
Lymphatic Metastasis Associate 36691407
Ovarian Neoplasms Associate 26823747
Rectal Neoplasms Associate 25973052