Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10267
Gene name	Receptor activity modifying protein 1
Gene symbol	RAMP1
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q37.3
Summary	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	20596610
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IPI	9620797, 10882736, 14722252
GO:0005515	Function	Protein binding	IPI	9620797, 14722252, 16293613, 20596610, 20826335, 32296183, 33602864
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	IDA	18039931
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9620797
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9620797, 17110384, 33602864, 35324283, 38603770
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	14722252
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	9620797, 10882736
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	14722252
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	9620797, 33602864, 35324283, 38603770
GO:0015026	Function	Coreceptor activity	IEA
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IDA	10882736
GO:0016020	Component	Membrane	IEA
GO:0031623	Process	Receptor internalization	IBA
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	15613468
GO:0060050	Process	Positive regulation of protein glycosylation	IDA	9620797
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	10882736
GO:0097643	Function	Amylin receptor activity	IPI	14722252
GO:0097647	Process	Amylin receptor signaling pathway	IDA	14722252
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283, 38603770
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283, 38603770
GO:1990406	Component	CGRP receptor complex	IDA	9620797, 10882736
GO:1990407	Function	Calcitonin gene-related peptide binding	IPI	9620797
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797, 33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797, 33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IPI	9620797, 10882736

MIM	HGNC	e!Ensembl
605153	9843	ENSG00000132329

O60894

Protein name

Receptor activity-modifying protein 1 (Calcitonin-receptor-like receptor activity-modifying protein 1) (CRLR activity-modifying protein 1)

Protein function

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR) (PubMed:33602864, PubMed:9620797, PubMed:35324283,

PDB

2YX8 , 3N7P , 3N7R , 3N7S , 4RWG , 5V6Y , 6D1U , 6E3Y , 6UMG , 6ZHO , 6ZIS , 7KNT , 7KNU , 7P0F , 7P0I , 7TYF , 7TYW , 8AX5 , 8AX6 , 8AX7 , 9AUC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04901	RAMP	37 → 146	Receptor activity modifying family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract. {ECO:0000269|PubMed:9620797}.

Sequence

MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV

Sequence length

148

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF DEVELOPMENT OR MORPHOGENESIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	39188714	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Associate	39188714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	27258937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Associate	23237777, 26501962, 34965002, 36627267, 40596821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	33602248	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	37796823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panniculitis Peritoneal	Associate	27258937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	19893039	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	36578802	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Associate	36627267	★★★★★ ★☆☆☆☆ Found in Text Mining only

RAMP1 (receptor activity modifying protein 1)