Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10266
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor activity modifying protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAMP2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments
MIRT1289326	hsa-miR-1255a	CLIP-seq
MIRT1289327	hsa-miR-1255b	CLIP-seq
MIRT1289328	hsa-miR-4450	CLIP-seq
MIRT1289329	hsa-miR-4693-3p	CLIP-seq
MIRT1289330	hsa-miR-4712-3p	CLIP-seq
MIRT1289331	hsa-miR-491-5p	CLIP-seq
MIRT1289332	hsa-miR-539	CLIP-seq
MIRT1289333	hsa-miR-541	CLIP-seq
MIRT1289334	hsa-miR-654-5p	CLIP-seq

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA	21873635
GO:0001525	Process	Angiogenesis	IDA	20596610
GO:0001570	Process	Vasculogenesis	IMP	16964401
GO:0001605	Function	Adrenomedullin receptor activity	IPI	9620797, 20074556, 22102369
GO:0001666	Process	Response to hypoxia	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0005515	Function	Protein binding	IPI	9620797, 20596610, 22102369, 30115739, 32296183
GO:0005737	Component	Cytoplasm	IDA	10882736
GO:0005764	Component	Lysosome	TAS	10882736
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9620797
GO:0005905	Component	Clathrin-coated pit	TAS	10882736
GO:0006816	Process	Calcium ion transport	IBA	21873635
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:0007507	Process	Heart development	ISS
GO:0007565	Process	Female pregnancy	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	14722252
GO:0010628	Process	Positive regulation of gene expression	IDA	18097473
GO:0015026	Function	Coreceptor activity	IBA	21873635
GO:0015026	Function	Coreceptor activity	ISS
GO:0015031	Process	Protein transport	IBA	21873635
GO:0015031	Process	Protein transport	IDA	9620797, 10882736
GO:0031623	Process	Receptor internalization	IBA	21873635
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468, 20074556
GO:0032092	Process	Positive regulation of protein binding	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA	21873635
GO:0034333	Process	Adherens junction assembly	IDA	18097473
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	ISS
GO:0043116	Process	Negative regulation of vascular permeability	IDA	18097473
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	15613468
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0070830	Process	Bicellular tight junction assembly	IDA	18097473
GO:0070831	Process	Basement membrane assembly	ISS
GO:0072659	Process	Protein localization to plasma membrane	IBA	21873635
GO:0072659	Process	Protein localization to plasma membrane	IDA	10882736
GO:0097084	Process	Vascular associated smooth muscle cell development	ISS
GO:0097643	Function	Amylin receptor activity	IGI	22500019
GO:0097647	Process	Amylin receptor signaling pathway	IGI	22500019
GO:0150057	Component	Amylin receptor complex 2	IDA	22500019
GO:1903143	Component	Adrenomedullin receptor complex	IDA	9620797, 10882736, 20074556, 22102369
GO:1990409	Function	Adrenomedullin binding	IPI	22102369
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	18097473
GO:2001214	Process	Positive regulation of vasculogenesis	IEA

MIM	HGNC	e!Ensembl
605154	9844	ENSG00000131477

Protein

UniProt ID

O60895

Protein name

Receptor activity-modifying protein 2 (Calcitonin-receptor-like receptor activity-modifying protein 2) (CRLR activity-modifying protein 2)

Protein function

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR) (PubMed:9620797). Required for the transport of CA

PDB

2XVT , 3AQE , 3AQF , 4RWF , 6UUN , 6V2E , 7TYH , 7TYX , 7TYY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04901	RAMP	65 → 173	Receptor activity modifying family	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in lung, breast, immune system and fetal tissues. {ECO:0000269|PubMed:9620797}.

Sequence

MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKN
YETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERII
FETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Sequence length

175

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	17671114
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	17671114
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	30718926
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	17671114

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Glaucoma	open-angle glaucoma	GenCC
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	36032660
Arthritis Rheumatoid	Associate	20942979
Coronary Artery Disease	Associate	17878224
Diabetes Gestational	Associate	28666334
Fetal Growth Retardation	Associate	27258937
Hyperoxia	Stimulate	34911614
Lung Injury	Associate	34911614
Obesity	Associate	34271220
Panniculitis Peritoneal	Associate	27258937
Reperfusion Injury	Associate	22183724
Stroke	Associate	28904253

RAMP2 (receptor activity modifying protein 2)