Gene Gene information from NCBI Gene database.
Entrez ID 10263
Gene name Cyclin dependent kinase 2 associated protein 2
Gene symbol CDK2AP2
Synonyms (NCBI Gene)
DOC-1RDOC1Rp14
Chromosome 11
Chromosome location 11q13.2
Summary This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided
miRNA miRNA information provided by mirtarbase database.
288
miRTarBase ID miRNA Experiments Reference
MIRT030237 hsa-miR-26b-5p Microarray 19088304
MIRT044773 hsa-miR-320a CLASH 23622248
MIRT560939 hsa-miR-4700-3p PAR-CLIP 20371350
MIRT560938 hsa-miR-2392 PAR-CLIP 20371350
MIRT560937 hsa-miR-130a-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 14985111, 23781148, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 33283408
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620061 30833 ENSG00000167797
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75956
Protein name Cyclin-dependent kinase 2-associated protein 2 (CDK2-associated protein 2) (DOC-1-related protein) (DOC-1R)
Protein function Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:33283408). Inhibits cell cycle G1/S phase transition by repressing CDK2 expression and activation; represses CDK2 activation by
PDB 2M1L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09806 CDK2AP 59 125 Cyclin-dependent kinase 2-associated protein Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10082655}.
Sequence
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQ
AMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAET
ERNAR
T
Sequence length 126
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
18
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs144468375 RCV005905278
Adrenocortical carcinoma, hereditary Benign rs144468375 RCV005905282
Cervical cancer Benign rs144468375 RCV005905283
Clear cell carcinoma of kidney Benign rs144468375 RCV005905284
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Neoplasms Inhibit 23781148