IGSF6 (immunoglobulin superfamily member 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10261
Gene name Gene Name - the full gene name approved by the HGNC.
Immunoglobulin superfamily member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IGSF6
Synonyms (NCBI Gene) Gene synonyms aliases
DORA
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p12.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1020)
miRTarBase ID miRNA Experiments Reference
MIRT028904 hsa-miR-26b-5p Microarray 19088304
MIRT628909 hsa-miR-15a-3p HITS-CLIP 23824327
MIRT628908 hsa-miR-205-3p HITS-CLIP 23824327
MIRT628907 hsa-miR-383-3p HITS-CLIP 23824327
MIRT629941 hsa-miR-4742-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 9809579
GO:0005887 Component Integral component of plasma membrane TAS 9809579
GO:0006955 Process Immune response TAS 9809579
GO:0007166 Process Cell surface receptor signaling pathway TAS 9809579
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606222 5953 ENSG00000140749
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O95976
Protein name Immunoglobulin superfamily member 6 (IgSF6) (Protein DORA)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 35 → 142 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood lymphocytes, spleen and lymph node, with low levels in thymus, bone marrow and fetal liver. No expression in non-immune tissues. {ECO:0000269|PubMed:9809579}.
Sequence 
MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPS
EQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGI
AFPSVPEARAKQTGGGTTLVVREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSK
SNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYER
P
Sequence length 241
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 16033404
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38037023
Atrial Fibrillation Associate 33741890
Colorectal Neoplasms Associate 37989761
COVID 19 Associate 38062828
Gastritis Associate 36973348
Hypertension Associate 32888289
Neoplasms Associate 38037023
Obesity Associate 37063877
Osteoporosis Associate 36973348
Periodontitis Associate 37063877