Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1026
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin dependent kinase inhibitor 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDKN1A
Synonyms (NCBI Gene) Gene synonyms aliases
CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000603 hsa-miR-106b-5p Luciferase reporter assay 18676839
MIRT000603 hsa-miR-106b-5p qRT-PCR 18676839
MIRT001223 hsa-miR-106a-5p qRT-PCR, Luciferase reporter assay, Western blot 18212054
MIRT000600 hsa-miR-17-5p qRT-PCR, Luciferase reporter assay, Western blot 18212054
MIRT000596 hsa-miR-20b-5p qRT-PCR, Luciferase reporter assay, Western blot 18212054
Transcription factors
Transcription factor Regulation Reference
AATF Unknown 17157788
ABL1 Activation 11753601;9916993
AR Activation 10076995
AR Repression 16281084
ARID1A Unknown 21900401
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 8242751
GO:0000082 Process G1/S transition of mitotic cell cycle IDA 10208428
GO:0000082 Process G1/S transition of mitotic cell cycle TAS
GO:0000086 Process G2/M transition of mitotic cell cycle IMP 17553787
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IDA 17420273
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
116899 1784 ENSG00000124762
Protein
UniProt ID P38936
Protein name Cyclin-dependent kinase inhibitor 1 (CDK-interacting protein 1) (Melanoma differentiation-associated protein 6) (MDA-6) (p21)
Protein function Plays an important role in controlling cell cycle progression and DNA damage-induced G2 arrest (PubMed:9106657). Involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage. Also involved in p53-independent DNA d
PDB 1AXC , 2ZVV , 2ZVW , 4RJF , 5E0U , 6CBI , 6CEJ , 6CIV , 6CIX , 6P8H , 7KQ0 , 7KQ1 , 8GJF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02234 CDI 20 68 Cyclin-dependent kinase inhibitor Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all adult tissues, with 5-fold lower levels observed in the brain.
Sequence
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERV
RGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance
Platinum drug resistance
ErbB signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
JAK-STAT signaling pathway
Oxytocin signaling pathway
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
  SCF(Skp2)-mediated degradation of p27/p21
AKT phosphorylates targets in the cytosol
Senescence-Associated Secretory Phenotype (SASP)
DNA Damage/Telomere Stress Induced Senescence
Constitutive Signaling by AKT1 E17K in Cancer
Interleukin-4 and Interleukin-13 signaling
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Cyclin E associated events during G1/S transition
Cyclin D associated events in G1
p53-Dependent G1 DNA Damage Response
Cyclin A:Cdk2-associated events at S phase entry
Transcriptional activation of cell cycle inhibitor p21
The role of GTSE1 in G2/M progression after G2 checkpoint
TFAP2 (AP-2) family regulates transcription of cell cycle factors
Transcriptional regulation by RUNX2
RUNX3 regulates CDKN1A transcription
Transcriptional regulation of granulopoiesis
FOXO-mediated transcription of cell cycle genes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adrenocortical adenoma Adrenal Cortical Adenoma rs121913035
Adrenocortical carcinoma Adrenocortical carcinoma rs121912656, rs28934874, rs121912662, rs786202525, rs121912664, rs397516435, rs121913343, rs587780070, rs121912666, rs55832599, rs587782144, rs587782272, rs587782529, rs587782620, rs587782664
View all (30 more)
Angiofibroma Angiofibroma rs121913034, rs267607234
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
29892015, 30061737
Unknown
Disease term Disease name Evidence References Source
Ischemic stroke Ischemic stroke 29531354 ClinVar
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015 ClinVar
Heart Failure Heart Failure GWAS
Atrial Fibrillation Atrial Fibrillation GWAS
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 20144199
ACTH Secreting Pituitary Adenoma Associate 35563252
Adenine Nucleotide Translocator Deficiency Associate 29548335
Adenocarcinoma Inhibit 11752463, 38019254
Adenocarcinoma Associate 12149142, 17160237, 18376798, 30272263
Adenocarcinoma of Lung Associate 10076567, 28550688, 30867372, 36054146, 9250158, 9804172
Adenoma Associate 11194193, 12865273, 17641414, 35563252
Adenoma Inhibit 12234290, 12354803, 34762658, 8701978
Adenoma Oxyphilic Associate 11786411
Adenomatous Polyposis Coli Associate 12865273