SLC17A2 (solute carrier family 17 member 2)

Gene

• Entrez ID: 10246
• Gene name: Solute carrier family 17 member 2
• Gene symbol: SLC17A2
• Synonyms (NCBI Gene): NPT3
• Chromosome: 6
• Chromosome location: 6p22.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019007	hsa-miR-335-5p	Microarray	18185580
MIRT1353410	hsa-miR-185	CLIP-seq
MIRT1353411	hsa-miR-4306	CLIP-seq
MIRT1353412	hsa-miR-4644	CLIP-seq
MIRT1353413	hsa-miR-4802-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005436	Function	Sodium:phosphate symporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	9149941
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9149941
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	9149941
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	TAS	9149941
GO:0015143	Function	Urate transmembrane transporter activity	IEA
GO:0015143	Function	Urate transmembrane transporter activity	ISS
GO:0015293	Function	Symporter activity	IEA
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015747	Process	Urate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9149941
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA

Other IDs

• MIM: 611049
• HGNC: 10930
• e!Ensembl: ENSG00000112337

Protein

• UniProt ID: O00624
• Protein name: Sodium-dependent phosphate transport protein 3 (Na(+)/PI cotransporter 3) (Sodium/phosphate cotransporter 3) (Solute carrier family 17 member 2)
• Protein function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions (By similarity). Mediates chloride-dependent transport of urate (By similarity). Can actively transport inorganic phosp
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	24 → 425	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the small intestine, kidney, spleen and testis. Not detected in fetal brain, bone marrow, and mammary gland. {ECO:0000269|PubMed:9149941}.
• Sequence:

  MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTE
  GPVADAFNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKK
  MLGAGLLISSLLTLFTPLAADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
  LTTIAGSGSAFGSFIILCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPC
  ISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYI
  STLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPS
  ICAVALPFVASSYVITIILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIA
  GIISSTATGFLISQVGPVY

• Sequence length: 439