Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10242
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium calcium-activated channel subfamily M regulatory beta subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNMB2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q26.32
Summary Summary of gene provided in NCBI Entrez Gene.	MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT734908	hsa-miR-3194-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization, Flow cytometry	34026626
MIRT1082087	hsa-miR-1276	CLIP-seq
MIRT1082088	hsa-miR-3942-5p	CLIP-seq
MIRT1082089	hsa-miR-4703-5p	CLIP-seq
MIRT1082090	hsa-miR-4719	CLIP-seq
MIRT1082091	hsa-miR-513b	CLIP-seq
MIRT2020422	hsa-miR-4778-3p	CLIP-seq
MIRT2252179	hsa-miR-181a	CLIP-seq
MIRT2252180	hsa-miR-181b	CLIP-seq
MIRT2252181	hsa-miR-181c	CLIP-seq
MIRT2252182	hsa-miR-181d	CLIP-seq
MIRT2252183	hsa-miR-4262	CLIP-seq
MIRT2252184	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IDA	10692449
GO:0005513	Process	Detection of calcium ion	IBA	21873635
GO:0005513	Process	Detection of calcium ion	IDA	10692449
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	10692449
GO:0006813	Process	Potassium ion transport	IDA	10692449
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	10692449
GO:0008200	Function	Ion channel inhibitor activity	TAS	10097176
GO:0015269	Function	Calcium-activated potassium channel activity	IBA	21873635
GO:0015269	Function	Calcium-activated potassium channel activity	IDA	10692449
GO:0015459	Function	Potassium channel regulator activity	IBA	21873635
GO:0019228	Process	Neuronal action potential	IDA	10692449
GO:0019229	Process	Regulation of vasoconstriction	TAS	10692449
GO:0071805	Process	Potassium ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605214	6286	ENSG00000197584

Protein

UniProt ID

Q9Y691

Protein name

Calcium-activated potassium channel subunit beta-2 (BK channel subunit beta-2) (BKbeta2) (Hbeta2) (Calcium-activated potassium channel, subfamily M subunit beta-2) (Charybdotoxin receptor subunit beta-2) (Hbeta3) (K(VCA)beta-2) (Maxi K channel subunit bet

Protein function

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and

PDB

1JO6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09303	KcnmB2_inactiv	1 → 32	KCNMB2, ball and chain domain	Domain
PF03185	CaKB	38 → 229	Calcium-activated potassium channel, beta subunit	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, heart and brain. Highly expressed in ovary. Expressed at low level in other tissues. {ECO:0000269|PubMed:10097176, ECO:0000269|PubMed:10377337, ECO:0000269|PubMed:10692449}.

Sequence

MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR

Sequence length

235

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Vascular smooth muscle contraction Insulin secretion		Ca2+ activated K+ channels

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder), AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	24529757
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	24529757
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	22688191

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Mental depression	Major Depressive Disorder	29317602	ClinVar
Asthma	Asthma		GWAS
Dementia	Dementia		GWAS
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	15234980, 17912626
Anemia Sickle Cell	Associate	24599433
Carcinogenesis	Associate	1654277
Cartilage Diseases	Associate	9741315
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	24599433
Diabetic Nephropathies	Associate	35909518
Diabetic Neuropathies	Associate	31041876
Epileptic Encephalopathy Early Infantile 3	Associate	27789573
Esophageal Neoplasms	Stimulate	34516362
Hippocampal Sclerosis	Associate	27003218, 28131462, 28189700, 34526147
Leukocyte adhesion deficiency type 1	Associate	9884339
limbic predominant age related TDP 43 encephalopathy	Associate	31039256
Uveal melanoma	Associate	18385798

KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2)