Gene Gene information from NCBI Gene database.
Entrez ID 10241
Gene name Calcium binding and coiled-coil domain 2
Gene symbol CALCOCO2
Synonyms (NCBI Gene)
NDP52
Chromosome 17
Chromosome location 17q21.32
Summary This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants enco
miRNA miRNA information provided by mirtarbase database.
837
miRTarBase ID miRNA Experiments Reference
MIRT001647 hsa-let-7b-5p pSILAC 18668040
MIRT021616 hsa-miR-142-3p Microarray 17612493
MIRT028168 hsa-miR-93-5p Sequencing 20371350
MIRT032106 hsa-let-7d-5p Sequencing 20371350
MIRT001647 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000421 Component Autophagosome membrane IEA
GO:0005515 Function Protein binding IPI 12869526, 16189514, 18330356, 18985028, 21516116, 21903422, 21988832, 22246324, 23022382, 23245322, 25416956, 25910212, 26871637, 28514442, 29892012, 31515488, 32296183, 32707033, 33961781, 34389544, 34524948
GO:0005634 Component Nucleus TAS 7540613
GO:0005737 Component Cytoplasm IDA 9230084
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604587 29912 ENSG00000136436
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13137
Protein name Calcium-binding and coiled-coil domain-containing protein 2 (Antigen nuclear dot 52 kDa protein) (Nuclear domain 10 protein NDP52) (Nuclear domain 10 protein 52) (Nuclear dot protein 52)
Protein function Xenophagy-specific receptor required for autophagy-mediated intracellular bacteria degradation. Acts as an effector protein of galectin-sensed membrane damage that restricts the proliferation of infecting pathogens such as Salmonella typhimurium
PDB 2MXP , 3VVV , 3VVW , 4GXL , 4HAN , 4XKL , 5AAQ , 5Z7A , 5Z7L , 7EAA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17751 SKICH 23 125 SKICH domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain. {ECO:0000269|PubMed:7540613}.
Sequence
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFR
VGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGAS
IPFQF
RPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ
EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ
QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQV
PTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL
Sequence length 446
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Mitophagy - animal
Autophagy - animal
Shigellosis
Influenza A