MRPS31 (mitochondrial ribosomal protein S31)

Gene

• Entrez ID: 10240
• Gene name: Mitochondrial ribosomal protein S31
• Gene symbol: MRPS31
• Synonyms (NCBI Gene): IMOGN38, MRP-S31, S31mt, mS31
• Chromosome: 13
• Chromosome location: 13q14.11
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031399	hsa-miR-16-5p	Proteomics	18668040
MIRT1160386	hsa-miR-325	CLIP-seq
MIRT1160387	hsa-miR-4282	CLIP-seq
MIRT1160388	hsa-miR-618	CLIP-seq
MIRT1160389	hsa-miR-628-3p	CLIP-seq
MIRT1160390	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	21988832
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	IEA
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005840	Component	Ribosome	IEA
GO:0019904	Function	Protein domain specific binding	IPI	11984006
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611992
• HGNC: 16632
• e!Ensembl: ENSG00000102738

Protein

• UniProt ID: Q92665
• Protein name: Small ribosomal subunit protein mS31 (28S ribosomal protein S31, mitochondrial) (MRP-S31) (S31mt) (Imogen 38)
• PDB: 3J9M, 6NU2, 6NU3, 6RW4, 6RW5, 6VLZ, 6VMI, 6ZM5, 6ZM6, 6ZS9, 6ZSA, 6ZSB, 6ZSC, 6ZSD, 6ZSE, 6ZSG, 7A5F, 7A5G, 7A5I, 7A5K, 7L08, 7OG4, 7P2E, 7PNX, 7PNY, 7PNZ, 7PO0, 7PO1, 7PO2, 7PO3, 7QI4, 7QI5, 7QI6, 8ANY, 8CSP, 8CSQ, 8CSR, 8CSS, 8CST, 8CSU, 8K2A, 8OIR, 8OIS, 8QRK, 8QRL, 8QRM, 8QRN, 8RRI, 8XT0, 8XT2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15433	MRP-S31	96 → 389	Mitochondrial 28S ribosomal protein S31	Family

• Sequence:

  MFPRVSTFLPLRPLSRHPLSSGSPETSAAAIMLLTVRHGTVRYRSSALLARTKNNIQRYF
  GTNSVICSKKDKQSVRTEETSKETSESQDSEKENTKKDLLGIIKGMKVELSTVNVRTTKP
  PKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKSELLSQ
  LQQHEEESRAQRDAKRPKISFSNIISDMKVARSATARVRSRPELRIQFDEGYDNYPGQEK
  TDDLKKRKNIFTGKRLNIFDMMAVTKEAPETDTSPSLWDVEFAKQLATVNEQPLQNGFEE
  LIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSK
  NPYLSVKQKVEHIEWFRNYFNEKKDILKESNIQFN

• Sequence length: 395

Pathways

Reactome:

Mitochondrial translation elongation
Mitochondrial translation termination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	34514952	★☆☆☆☆ Found in Text Mining only
Adenoma	Inhibit	32992457	★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	24718460	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34772924	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	38291374	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	34772924	★☆☆☆☆ Found in Text Mining only
Myopathy with Giant Abnormal Mitochondria	Associate	38291374	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32992457	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	33934540	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	36593912	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	24718460	★☆☆☆☆ Found in Text Mining only