Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10228
Gene name Gene Name - the full gene name approved by the HGNC.
Syntaxin 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STX6
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q25.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019742 hsa-miR-375 Microarray 20215506
MIRT719702 hsa-miR-4308 HITS-CLIP 19536157
MIRT719701 hsa-miR-4292 HITS-CLIP 19536157
MIRT719700 hsa-miR-6791-5p HITS-CLIP 19536157
MIRT719699 hsa-miR-130b-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0000149 Function SNARE binding IBA
GO:0005484 Function SNAP receptor activity IBA
GO:0005484 Function SNAP receptor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603944 11441 ENSG00000135823
Protein
UniProt ID O43752
Protein name Syntaxin-6
Protein function SNARE promoting movement of transport vesicles to target membranes. Targets endosomes to the trans-Golgi network, and may therefore function in retrograde trafficking. Together with SNARE STX12, promotes movement of vesicles from endosomes to th
PDB 2NPS , 4J2C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09177 Syntaxin-6_N 5 103 Syntaxin 6, N-terminal Domain
PF05739 SNARE 199 251 SNARE domain Family
Sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMK
DQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSI
GVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLIL
FLVL
Sequence length 255
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  SNARE interactions in vesicular transport   Intra-Golgi traffic
Retrograde transport at the Trans-Golgi-Network
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Progressive Supranuclear Palsy Progressive supranuclear palsy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34937778
Arthritis Rheumatoid Associate 33482886
Carcinoma Hepatocellular Stimulate 37564208
Carcinoma Ovarian Epithelial Associate 37378930
Carcinoma Renal Cell Associate 30816681
Creutzfeldt Jakob Disease Sporadic Associate 32949544
Frontotemporal Lobar Degeneration Associate 40618089
Neoplasm Metastasis Stimulate 37564208
Neoplasms Associate 37378930, 37564208
Peritoneal Neoplasms Associate 37378930