Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10225
Gene name Gene Name - the full gene name approved by the HGNC.
CD96 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD96
Synonyms (NCBI Gene) Gene synonyms aliases
TACTILE
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.13-q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also fun
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs119477056 C>A,T Pathogenic Non coding transcript variant, missense variant, intron variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019019 hsa-miR-335-5p Microarray 18185580
MIRT682964 hsa-miR-1273g-3p HITS-CLIP 23706177
MIRT682963 hsa-miR-4252 HITS-CLIP 23706177
MIRT682962 hsa-miR-6807-5p HITS-CLIP 23706177
MIRT680068 hsa-miR-186-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002728 Process Negative regulation of natural killer cell cytokine production IEA
GO:0005737 Component Cytoplasm IDA 17847009
GO:0005886 Component Plasma membrane TAS 1313846
GO:0006954 Process Inflammatory response IBA
GO:0006955 Process Immune response TAS 1313846
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606037 16892 ENSG00000153283
Protein
UniProt ID P40200
Protein name T-cell surface protein tactile (Cell surface antigen CD96) (T cell-activated increased late expression protein) (CD antigen CD96)
Protein function May be involved in adhesive interactions of activated T and NK cells during the late phase of the immune response. Promotes NK cell-target adhesion by interacting with PVR present on target cells. May function at a time after T and NK cells have
PDB 6ARQ
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed on normal T-cell lines and clones, and some transformed T-cells, but no other cultured cell lines tested. It is expressed at very low levels on activated B-cells.
Sequence
MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSK
VTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECML
VLYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWS
VENSSTDSWVLLSKGIKEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFD
DGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFTCLLKNVFPKAN
ITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSP
VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLV
DVSALRPNTTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLHDN
VFTSTARAFSEVPTTANGSTKTNHVHITGIVVNKPKDGMSWPVIVAALLFCCMILFGLGV
RKWCQYQKEIMERPPPFKPPPPPIKYTCIQEPNESDLPYHEMETL
Sequence length 585
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
C Syndrome c syndrome rs119477056 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Metabolic Syndrome Serum polyunsaturated fatty acid concentration x Mediterranean diet adherence interaction in metabolic syndrome N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35946526
Angina Pectoris Inhibit 26823790
Breast Neoplasms Associate 30947698
Carcinogenesis Associate 36043142
Colorectal Neoplasms Associate 30383736
Connective Tissue Diseases Associate 22208759
Drug Related Side Effects and Adverse Reactions Stimulate 23272144
Dwarfism Pituitary Associate 40660273
Fibromyalgia Associate 34913882
Genetic Diseases Inborn Associate 22208759