Gene Gene information from NCBI Gene database.
Entrez ID 10219
Gene name Killer cell lectin like receptor G1
Gene symbol KLRG1
Synonyms (NCBI Gene)
2F1CLEC15AMAFAMAFA-2F1MAFA-LMAFA-LIKE
Chromosome 12
Chromosome location 12p13.31
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t
miRNA miRNA information provided by mirtarbase database.
79
miRTarBase ID miRNA Experiments Reference
MIRT036992 hsa-miR-877-3p CLASH 23622248
MIRT1099389 hsa-miR-103b CLIP-seq
MIRT1099390 hsa-miR-1184 CLIP-seq
MIRT1099391 hsa-miR-150 CLIP-seq
MIRT1099392 hsa-miR-1915 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 16189514, 25416956, 32296183, 32814053
GO:0005886 Component Plasma membrane IEA
GO:0006954 Process Inflammatory response TAS 9842918
GO:0006968 Process Cellular defense response TAS 9842918
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604874 6380 ENSG00000139187
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96E93
Protein name Killer cell lectin-like receptor subfamily G member 1 (C-type lectin domain family 15 member A) (ITIM-containing receptor MAFA-L) (MAFA-like receptor) (Mast cell function-associated antigen)
Protein function Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expressio
PDB 3FF7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 92 186 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. {ECO:0000269|PubMed:15879103, ECO:0000269|PubMed:9842918}.
Sequence
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWIL
CQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMS
LLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPL
HWVCKK
CPFADQALF
Sequence length 195
Interactions View interactions