Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10219
Gene name Gene Name - the full gene name approved by the HGNC.	Killer cell lectin like receptor G1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KLRG1
Synonyms (NCBI Gene) Gene synonyms aliases	2F1, CLEC15A, MAFA, MAFA-2F1, MAFA-L, MAFA-LIKE
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.	Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t

Show/Hide all(79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036992	hsa-miR-877-3p	CLASH	23622248
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099394	hsa-miR-3200-5p	CLIP-seq
MIRT1099395	hsa-miR-365	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099398	hsa-miR-4251	CLIP-seq
MIRT1099399	hsa-miR-4329	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099401	hsa-miR-4420	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099405	hsa-miR-4729	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099409	hsa-miR-539	CLIP-seq
MIRT1099410	hsa-miR-633	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT2258177	hsa-miR-1343	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT2258178	hsa-miR-378g	CLIP-seq
MIRT2258179	hsa-miR-4307	CLIP-seq
MIRT2258180	hsa-miR-431	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT2258181	hsa-miR-4437	CLIP-seq
MIRT2258182	hsa-miR-455-3p	CLIP-seq
MIRT2258183	hsa-miR-4670-5p	CLIP-seq
MIRT2258184	hsa-miR-4674	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT2258185	hsa-miR-4716-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IEA
GO:0006954	Process	Inflammatory response	TAS	9842918
GO:0006968	Process	Cellular defense response	TAS	9842918
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9842918
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9842918
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	9765598
GO:0038023	Function	Signaling receptor activity	TAS	9765598
GO:0045087	Process	Innate immune response	IEA

MIM	HGNC	e!Ensembl
604874	6380	ENSG00000139187

Protein

UniProt ID

Q96E93

Protein name

Killer cell lectin-like receptor subfamily G member 1 (C-type lectin domain family 15 member A) (ITIM-containing receptor MAFA-L) (MAFA-like receptor) (Mast cell function-associated antigen)

Protein function

Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expressio

PDB

3FF7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	92 → 186	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. {ECO:0000269|PubMed:15879103, ECO:0000269|PubMed:9842918}.

Sequence

MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWIL
CQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMS
LLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPL
HWVCKKCPFADQALF

Sequence length

195

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	34187403
Angina Pectoris	Inhibit	26823790
Autoimmune Diseases	Associate	27424220, 28076899
Breast Neoplasms	Associate	34386013
Cardiomyopathies	Associate	39294340
Cholangitis Sclerosing	Associate	36059513
Colorectal Neoplasms	Stimulate	32393998
Colorectal Neoplasms	Associate	35192548
Cytomegalovirus Infections	Associate	25385851
Down Syndrome	Associate	31699819
Drug Related Side Effects and Adverse Reactions	Stimulate	40147444
Fatigue Syndrome Chronic	Associate	26032326
HIV Infections	Associate	26611787, 32954948, 37741278
Immune Reconstitution Inflammatory Syndrome	Stimulate	31022273
Infarction	Associate	25385851
Infections	Associate	34226281
Inflammation	Associate	26295359, 27557510, 28678593, 33298584
Inflammation	Stimulate	31255417
Kidney Neoplasms	Associate	37657842
Leukemia	Associate	40147444
Leukemia Large Granular Lymphocytic	Associate	40147444
Leukemia Lymphocytic Chronic B Cell	Associate	27302925
Leukemia Myeloid Acute	Associate	3513178
Leukemia Prolymphocytic	Associate	1680497
Leukemia Prolymphocytic T Cell	Associate	1680497
Lichen Planus Oral	Stimulate	35904747
Liver Cirrhosis	Associate	31255417
Liver Cirrhosis Biliary	Associate	31255417
Lung Diseases Interstitial	Associate	33298584
Lung Neoplasms	Associate	35981786
Lupus Erythematosus Systemic	Associate	19440200
Lymphoma Follicular	Associate	34226281
Lymphoma T Cell	Associate	37325644
Lymphoproliferative Disorders	Associate	20132662
Metabolic Syndrome	Associate	26611787
Mouth Neoplasms	Associate	36096526
Multiple Myeloma	Associate	37054944
Multiple Sclerosis	Associate	34667129
Multiple Sclerosis Relapsing Remitting	Associate	35711452
Myocardial Infarction	Inhibit	26823790
Myositis Inclusion Body	Stimulate	35131904
Neoplasms	Associate	27557510, 27566818, 29197680, 29587679, 32393998, 34187403, 34386013, 37657842
Neoplasms	Inhibit	36472588
Niemann Pick Disease Type C	Associate	19762521
Nijmegen Breakage Syndrome	Associate	32695108
Pancreatic Neoplasms	Associate	36472588
Pemphigus	Associate	27424220
Pulmonary Embolism	Associate	26339393
Sjogren's Syndrome	Associate	28076899
Uterine Cervical Dysplasia	Stimulate	35413989
Uveitis Anterior	Associate	33807229

KLRG1 (killer cell lectin like receptor G1)