Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10218
Gene name	Angiopoietin like 7
Gene symbol	ANGPTL7
Synonyms (NCBI Gene)	AngXCDT6dJ647M16.1
Chromosome	1
Chromosome location	1p36.22

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022433	hsa-miR-124-3p	Microarray	18668037
MIRT645301	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT645300	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT645299	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645298	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645297	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645296	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT645295	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT645294	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT645293	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT645292	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT645291	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT645290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT645289	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT645288	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645287	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645286	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT645285	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT645284	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT645283	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645282	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645281	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT732959	hsa-miR-1270	MicroarrayRNA-seqqRT-PCR	34070163
MIRT645301	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT645300	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT645299	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645298	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645297	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645296	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT645295	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT645294	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT645293	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT645292	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT645291	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT645290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT645289	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT645288	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645287	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645286	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT645285	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT645284	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT645283	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645282	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645281	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT781559	hsa-miR-1273f	CLIP-seq
MIRT781560	hsa-miR-143	CLIP-seq
MIRT781561	hsa-miR-3609	CLIP-seq
MIRT781562	hsa-miR-3674	CLIP-seq
MIRT781563	hsa-miR-4708-5p	CLIP-seq
MIRT781564	hsa-miR-4770	CLIP-seq
MIRT781565	hsa-miR-488	CLIP-seq
MIRT781566	hsa-miR-520d-5p	CLIP-seq
MIRT781567	hsa-miR-520g	CLIP-seq
MIRT781568	hsa-miR-520h	CLIP-seq
MIRT781569	hsa-miR-524-5p	CLIP-seq
MIRT781570	hsa-miR-548ah	CLIP-seq
MIRT1930690	hsa-miR-2113	CLIP-seq
MIRT2171290	hsa-miR-1305	CLIP-seq
MIRT2171291	hsa-miR-4328	CLIP-seq
MIRT2171292	hsa-miR-4724-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25910212
GO:0005576	Component	Extracellular region	IDA	11682471
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006979	Process	Response to oxidative stress	TAS	8026862
GO:0007596	Process	Blood coagulation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0042802	Function	Identical protein binding	IDA	11682471
GO:1901346	Process	Negative regulation of vasculature development involved in avascular cornea development in camera-type eye	IMP	25622036
GO:1903053	Process	Regulation of extracellular matrix organization	IMP	21199193

MIM	HGNC	e!Ensembl
618517	24078	ENSG00000171819

O43827

Protein name

Angiopoietin-related protein 7 (Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein)

Protein function

Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	127 → 342	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the cornea (at protein level) (PubMed:11682471). Expression is restricted to the stromal layer (PubMed:11682471). Also detected at the junction between the corneal stromal layer and the conjuctiva. Not detected in t

Sequence

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLS
SLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTV
TQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSG
LVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVL
GNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD
SNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

Sequence length

346

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37350390	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	34685578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous embolism	Associate	32943704	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Associate	21199193, 28264047, 32369491, 37220876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Associate	32369491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Associate	32369491, 32913388, 37220876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	28264047, 36078120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	34685578	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	28264047	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Stimulate	36017324	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	36399105	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANGPTL7 (angiopoietin like 7)