Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	102157402
Gene name	Adenylate kinase 6
Gene symbol	AK6
Synonyms (NCBI Gene)	AD-004CGI-137CINAPCIPhCINAP
Chromosome	5
Chromosome location	5q13.2
Summary	This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Ca

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004017	Function	AMP kinase activity	IBA
GO:0004017	Function	AMP kinase activity	IDA	15630091
GO:0004017	Function	AMP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16079131, 25416956, 28514442
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	16079131
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	16079131
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0006364	Process	RRNA processing	IEA
GO:0015030	Component	Cajal body	IDA	16079131
GO:0015030	Component	Cajal body	IEA
GO:0015949	Process	Nucleobase-containing small molecule interconversion	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IEA
GO:0046940	Process	Nucleoside monophosphate phosphorylation	IEA
GO:0050145	Function	Nucleoside monophosphate kinase activity	TAS

MIM	HGNC	e!Ensembl
619357	49151	ENSG00000085231

Q9Y3D8

Protein name

Adenylate kinase isoenzyme 6 (AK6) (EC 2.7.4.3) (Adrenal gland protein AD-004) (Coilin-interacting nuclear ATPase protein) (hCINAP) (Dual activity adenylate kinase/ATPase) (AK/ATPase)

Protein function

Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Also has ATPase activity (PubMed:15630091). Involved in the late

PDB

1RKB , 3IIJ , 3IIK , 3IIL , 3IIM , 5JZV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13238	AAA_18	6 → 126		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, chorionic villi and the central nervous system. {ECO:0000269|PubMed:16079131}.

Sequence

MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDR
VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNI
QCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

Sequence length

172

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors Ribosome biogenesis in eukaryotes		Interconversion of nucleotide di- and triphosphates

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	12230554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Associate	20186459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	28106536	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	38551450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	33300073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	33300073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	16565223	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	33300073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	12548606, 24019070	★★★★★ ★☆☆☆☆ Found in Text Mining only

AK6 (adenylate kinase 6)