Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10215
Gene name	Oligodendrocyte transcription factor 2
Gene symbol	OLIG2
Synonyms (NCBI Gene)	BHLHB1OLIGO2PRKCBP2RACK17bHLHe19
Chromosome	21
Chromosome location	21q22.11
Summary	This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024220	hsa-miR-218-5p	Sequencing	20371350
MIRT1203299	hsa-miR-1179	CLIP-seq
MIRT1203300	hsa-miR-140-5p	CLIP-seq
MIRT1203301	hsa-miR-2115	CLIP-seq
MIRT1203302	hsa-miR-3125	CLIP-seq
MIRT1203303	hsa-miR-3202	CLIP-seq
MIRT1203304	hsa-miR-3689d	CLIP-seq
MIRT1203305	hsa-miR-383	CLIP-seq
MIRT1203306	hsa-miR-3916	CLIP-seq
MIRT1203307	hsa-miR-4257	CLIP-seq
MIRT1203308	hsa-miR-4446-5p	CLIP-seq
MIRT1203309	hsa-miR-4474-3p	CLIP-seq
MIRT1203310	hsa-miR-4476	CLIP-seq
MIRT1203311	hsa-miR-4637	CLIP-seq
MIRT1203312	hsa-miR-4694-5p	CLIP-seq
MIRT1203313	hsa-miR-609	CLIP-seq
MIRT2058705	hsa-miR-1252	CLIP-seq
MIRT2058706	hsa-miR-3925-5p	CLIP-seq
MIRT2286885	hsa-miR-1539	CLIP-seq
MIRT2286886	hsa-miR-3193	CLIP-seq
MIRT2286887	hsa-miR-4667-3p	CLIP-seq
MIRT2286888	hsa-miR-4749-3p	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0021522	Process	Spinal cord motor neuron differentiation	IEA
GO:0021529	Process	Spinal cord oligodendrocyte cell differentiation	IEA
GO:0021530	Process	Spinal cord oligodendrocyte cell fate specification	IEA
GO:0021778	Process	Oligodendrocyte cell fate specification	IEA
GO:0021794	Process	Thalamus development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:0071837	Function	HMG box domain binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
606386	9398	ENSG00000205927

Q13516

Protein name

Oligodendrocyte transcription factor 2 (Oligo2) (Class B basic helix-loop-helix protein 1) (bHLHb1) (Class E basic helix-loop-helix protein 19) (bHLHe19) (Protein kinase C-binding protein 2) (Protein kinase C-binding protein RACK17)

Protein function

Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	109 → 163	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable. {ECO:0000269|PubMed:11498220, ECO:0000269|PubMed:

Sequence

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK

Sequence length

323

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs1387063879	RCV004557853

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	39643224
Astrocytoma	Associate	21193945
Autism Spectrum Disorder	Associate	35967956
Autistic Disorder	Associate	31808517
Brain Injuries	Associate	30636077
Brain Neoplasms	Associate	18552083, 22691720, 27447975
Breast Neoplasms	Stimulate	27340107
Cancer Pain	Inhibit	24690158
Carcinogenesis	Associate	17951409, 35856894
Central Nervous System Infections	Associate	22691720, 29226988
Creutzfeldt Jakob Syndrome	Associate	30009661
Diabetes Mellitus Type 1	Associate	15635070
Diffuse Intrinsic Pontine Glioma	Associate	24076776, 33539525
Down Syndrome	Associate	10737801, 30989628
Ependymoma	Associate	18552083
Epilepsy Temporal Lobe	Associate	36274170, 39377933
Glioblastoma	Associate	18837053, 23041832, 24726434, 25384509, 27160082, 27165737, 27179219, 27852622, 29773872, 30158599, 30497369, 31568682, 31655917, 34282187, 34565408 View all (4 more)
Glioblastoma	Stimulate	21193945
Glioma	Inhibit	17951409
Glioma	Associate	18492260, 18837053, 21193945, 22380883, 22627626, 23041832, 23793848, 24410805, 27447975, 28760688, 32160197, 32999376, 35856894
Glioma	Stimulate	31655917, 33833342
Gliosarcoma	Associate	23041832
Learning Disabilities	Associate	10737801
Leukemia	Associate	18523155, 28760688
Leukemia Myeloid Acute	Associate	18523155, 28760688
Leukoencephalopathies	Associate	22505278
Lung Neoplasms	Stimulate	33833342
Melanoma	Stimulate	33833342
Mental Disorders	Associate	22505278
Multiple Sclerosis	Associate	17360586
Multiple System Atrophy	Associate	31870437
Neoplasm Metastasis	Associate	22691720
Neoplasms	Associate	18837053, 21169070, 21193945, 23324350, 24076776, 26817999, 27074032, 28990708, 29141672, 31882550, 33370704, 33539525, 34355256, 34628794, 35114775, 35713454 View all (1 more)
Neoplasms	Stimulate	33833342
Neoplasms	Inhibit	34967922
Neoplasms Neuroepithelial	Associate	27416954
Neurocytoma	Associate	34628794
Neuroectodermal Tumors Primitive	Associate	22691720, 23041832, 27074032
Obsessive Compulsive Disorder	Associate	31808517
Oligodendroglioma	Associate	18552083, 18796682, 34628794, 35114775, 35856894, 36525723
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	10737801
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	31882550
Rhabdomyosarcoma	Associate	31493794
Schizophrenia	Associate	22505278, 35967956

OLIG2 (oligodendrocyte transcription factor 2)