OLIG2 (oligodendrocyte transcription factor 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10215
Gene name Gene Name - the full gene name approved by the HGNC.
Oligodendrocyte transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OLIG2
Synonyms (NCBI Gene) Gene synonyms aliases
BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(22)
miRTarBase ID miRNA Experiments Reference
MIRT024220 hsa-miR-218-5p Sequencing 20371350
MIRT1203299 hsa-miR-1179 CLIP-seq
MIRT1203300 hsa-miR-140-5p CLIP-seq
MIRT1203301 hsa-miR-2115 CLIP-seq
MIRT1203302 hsa-miR-3125 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606386 9398 ENSG00000205927
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q13516
Protein name Oligodendrocyte transcription factor 2 (Oligo2) (Class B basic helix-loop-helix protein 1) (bHLHb1) (Class E basic helix-loop-helix protein 19) (bHLHe19) (Protein kinase C-binding protein 2) (Protein kinase C-binding protein RACK17)
Protein function Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 109 → 163 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable. {ECO:0000269|PubMed:11498220, ECO:0000269|PubMed:
Sequence 
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Sequence length 323
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 17964117, 18996920, 19477230, 17934761, 17010574
Show/Hide Text Mining Associations (44)
Associations from Text Mining
Disease Name Relationship Type References
Asthma Associate 39643224
Astrocytoma Associate 21193945
Autism Spectrum Disorder Associate 35967956
Autistic Disorder Associate 31808517
Brain Injuries Associate 30636077
Brain Neoplasms Associate 18552083, 22691720, 27447975
Breast Neoplasms Stimulate 27340107
Cancer Pain Inhibit 24690158
Carcinogenesis Associate 17951409, 35856894
Central Nervous System Infections Associate 22691720, 29226988