Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10215
Gene name Gene Name - the full gene name approved by the HGNC.	Oligodendrocyte transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OLIG2
Synonyms (NCBI Gene) Gene synonyms aliases	BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl

Show/Hide all(22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024220	hsa-miR-218-5p	Sequencing	20371350
MIRT1203299	hsa-miR-1179	CLIP-seq
MIRT1203300	hsa-miR-140-5p	CLIP-seq
MIRT1203301	hsa-miR-2115	CLIP-seq
MIRT1203302	hsa-miR-3125	CLIP-seq
MIRT1203303	hsa-miR-3202	CLIP-seq
MIRT1203304	hsa-miR-3689d	CLIP-seq
MIRT1203305	hsa-miR-383	CLIP-seq
MIRT1203306	hsa-miR-3916	CLIP-seq
MIRT1203307	hsa-miR-4257	CLIP-seq
MIRT1203308	hsa-miR-4446-5p	CLIP-seq
MIRT1203309	hsa-miR-4474-3p	CLIP-seq
MIRT1203310	hsa-miR-4476	CLIP-seq
MIRT1203311	hsa-miR-4637	CLIP-seq
MIRT1203312	hsa-miR-4694-5p	CLIP-seq
MIRT1203313	hsa-miR-609	CLIP-seq
MIRT2058705	hsa-miR-1252	CLIP-seq
MIRT2058706	hsa-miR-3925-5p	CLIP-seq
MIRT2286885	hsa-miR-1539	CLIP-seq
MIRT2286886	hsa-miR-3193	CLIP-seq
MIRT2286887	hsa-miR-4667-3p	CLIP-seq
MIRT2286888	hsa-miR-4749-3p	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0021522	Process	Spinal cord motor neuron differentiation	IEA
GO:0021529	Process	Spinal cord oligodendrocyte cell differentiation	IEA
GO:0021530	Process	Spinal cord oligodendrocyte cell fate specification	IEA
GO:0021778	Process	Oligodendrocyte cell fate specification	IEA
GO:0021794	Process	Thalamus development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:0071837	Function	HMG box domain binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
606386	9398	ENSG00000205927

Protein

UniProt ID

Q13516

Protein name

Oligodendrocyte transcription factor 2 (Oligo2) (Class B basic helix-loop-helix protein 1) (bHLHb1) (Class E basic helix-loop-helix protein 19) (bHLHe19) (Protein kinase C-binding protein 2) (Protein kinase C-binding protein RACK17)

Protein function

Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	109 → 163	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable. {ECO:0000269|PubMed:11498220, ECO:0000269|PubMed:

Sequence

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK

Sequence length

323

Interactions

View interactions

OLIG2 (oligodendrocyte transcription factor 2)