Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10211
Gene name Gene Name - the full gene name approved by the HGNC.	Flotillin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FLOT1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. [provided

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024958	hsa-miR-214-3p	Microarray;Other	19859982
MIRT047187	hsa-miR-182-5p	CLASH	23622248
MIRT044822	hsa-miR-320a	CLASH	23622248
MIRT041850	hsa-miR-484	CLASH	23622248
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, Western blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, qRT-PCR, Western blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, qRT-PCR, Western blot	26807169
MIRT438215	hsa-miR-124-3p	Western blot	26002553
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998854	hsa-miR-1225-5p	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998856	hsa-miR-1271	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998858	hsa-miR-132	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998862	hsa-miR-212	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998864	hsa-miR-3132	CLIP-seq
MIRT998865	hsa-miR-3135b	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998868	hsa-miR-3920	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998875	hsa-miR-4476	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998879	hsa-miR-4653-3p	CLIP-seq
MIRT998880	hsa-miR-4666-5p	CLIP-seq
MIRT998881	hsa-miR-4715-5p	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998884	hsa-miR-548p	CLIP-seq
MIRT998885	hsa-miR-570	CLIP-seq
MIRT998886	hsa-miR-571	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998888	hsa-miR-622	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998890	hsa-miR-96	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT1995993	hsa-miR-4648	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001931	Component	Uropod	IDA	21696602
GO:0001931	Component	Uropod	IEA
GO:0002020	Function	Protease binding	IBA
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	24612608
GO:0002090	Process	Regulation of receptor internalization	IBA
GO:0002090	Process	Regulation of receptor internalization	IEA
GO:0005515	Function	Protein binding	IPI	15469992, 16480949, 17113085, 21119006, 21696602, 24167781, 24809731, 25959826, 30021884, 30614533, 32296183, 32814053
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005768	Component	Endosome	IDA	20682791
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21399631
GO:0005815	Component	Microtubule organizing center	IDA	18000879
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21399631
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21696602
GO:0005886	Component	Plasma membrane	TAS	9153235
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	TAS	9153235
GO:0005911	Component	Cell-cell junction	IDA	25468996
GO:0005912	Component	Adherens junction	IDA	24046456
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007409	Process	Axonogenesis	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	23983584
GO:0016324	Component	Apical plasma membrane	IDA	23983584
GO:0016600	Component	Flotillin complex	IBA
GO:0016600	Component	Flotillin complex	IDA	21399631, 21696602, 24046456, 25204797
GO:0016600	Component	Flotillin complex	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0022617	Process	Extracellular matrix disassembly	IMP	21119006
GO:0030027	Component	Lamellipodium	IDA	24046456
GO:0030864	Component	Cortical actin cytoskeleton	IDA	24046456
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	23983584
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	IEA
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	ISS
GO:0034332	Process	Adherens junction organization	IMP	24046456
GO:0034451	Component	Centriolar satellite	IDA	18000879
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	23319823
GO:0044291	Component	Cell-cell contact zone	IDA	23983584
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0044854	Process	Plasma membrane raft assembly	IMP	21399631
GO:0044857	Process	Plasma membrane raft organization	IMP	25204797
GO:0045121	Component	Membrane raft	IDA	15469992, 25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0045807	Process	Positive regulation of endocytosis	IBA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	21399631
GO:0048643	Process	Positive regulation of skeletal muscle tissue development	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0051580	Process	Regulation of neurotransmitter uptake	IDA	21399631
GO:0051580	Process	Regulation of neurotransmitter uptake	IMP	21399631
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070836	Process	Caveola assembly	IMP	25204797
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IMP	24612608
GO:0098691	Component	Dopaminergic synapse	IDA	21399631
GO:0098691	Component	Dopaminergic synapse	IMP	21399631
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1901890	Process	Positive regulation of cell junction assembly	IBA
GO:1901890	Process	Positive regulation of cell junction assembly	IEA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IBA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA

MIM	HGNC	e!Ensembl
606998	3757	ENSG00000137312

Protein

UniProt ID

O75955

Protein name

Flotillin-1

Protein function

May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.

PDB

9BQ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01145	Band_7	3 → 185	SPFH domain / Band 7 family	Family

Sequence

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Insulin signaling pathway		Synaptic adhesion-like molecules

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dental caries	Dental caries	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30838797, 37011005
Arthritis Rheumatoid	Associate	27898717
Breast Neoplasms	Associate	24304721, 24330780, 28327197, 31562347
Carcinogenesis	Associate	24277378
Carcinoma Hepatocellular	Associate	23840303, 27588480
Carcinoma Hepatocellular	Stimulate	25243186
Carcinoma Non Small Cell Lung	Associate	24277378, 24533441, 27448302
Carcinoma Renal Cell	Associate	25793370, 26002553
Cardiomyopathy Dilated	Associate	35327947
COVID 19	Associate	37486005
Depressive Disorder Major	Stimulate	30771789
Epidermodysplasia Verruciformis	Associate	35012489
Frontotemporal Dementia	Associate	26373282
Glioblastoma	Associate	36647700, 37441590
Glomerulonephritis IGA	Associate	36709307, 39516745
Kidney Failure Chronic	Associate	30212930
Kidney Neoplasms	Associate	25793370
Lymphatic Metastasis	Associate	24277378, 25685297
Neoplasm Metastasis	Associate	25793370, 37928269
Neoplasm Metastasis	Stimulate	35990908
Neoplasms	Associate	23840303, 24277378, 25243186, 25793370, 30631151, 30838797, 32343879, 35990908, 37441590
Neoplasms	Stimulate	36647700
Neoplasms Squamous Cell	Associate	24695539
Olivopontocerebellar Atrophies	Associate	26373282
Polycystic Kidney Autosomal Dominant	Associate	25180832
Prostatic Neoplasms	Associate	25685297, 30631151
Sarcoma	Associate	24533441
Sepsis	Associate	33949285
Stevens Johnson Syndrome	Associate	29202707
Stomach Neoplasms	Associate	25948494
Stomach Neoplasms	Stimulate	35990908, 37928269
Uterine Cervical Neoplasms	Associate	32343879

FLOT1 (flotillin 1)