Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	10211
Gene name	Flotillin 1
Gene symbol	FLOT1
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6p21.33
Summary	This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. [provided

101

Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024958	hsa-miR-214-3p	Microarray;Other	19859982
MIRT047187	hsa-miR-182-5p	CLASH	23622248
MIRT044822	hsa-miR-320a	CLASH	23622248
MIRT041850	hsa-miR-484	CLASH	23622248
MIRT438215	hsa-miR-124-3p	Luciferase reporter assayqRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assayqRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assayqRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assayqRT-PCR	24330780
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT731296	hsa-miR-485-5p	Luciferase reporter assayWestern blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assayqRT-PCRWestern blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assayqRT-PCRWestern blot	26807169
MIRT438215	hsa-miR-124-3p	Western blot	26002553
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998854	hsa-miR-1225-5p	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998856	hsa-miR-1271	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998858	hsa-miR-132	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998862	hsa-miR-212	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998864	hsa-miR-3132	CLIP-seq
MIRT998865	hsa-miR-3135b	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998868	hsa-miR-3920	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998875	hsa-miR-4476	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998879	hsa-miR-4653-3p	CLIP-seq
MIRT998880	hsa-miR-4666-5p	CLIP-seq
MIRT998881	hsa-miR-4715-5p	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998884	hsa-miR-548p	CLIP-seq
MIRT998885	hsa-miR-570	CLIP-seq
MIRT998886	hsa-miR-571	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998888	hsa-miR-622	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998890	hsa-miR-96	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT1995993	hsa-miR-4648	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001931	Component	Uropod	IDA	21696602
GO:0001931	Component	Uropod	IEA
GO:0002020	Function	Protease binding	IBA
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	24612608
GO:0002090	Process	Regulation of receptor internalization	IBA
GO:0002090	Process	Regulation of receptor internalization	IEA
GO:0005515	Function	Protein binding	IPI	15469992, 16480949, 17113085, 21119006, 21696602, 24167781, 24809731, 25959826, 30021884, 30614533, 32296183, 32814053
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005768	Component	Endosome	IDA	20682791
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21399631
GO:0005815	Component	Microtubule organizing center	IDA	18000879
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21399631
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21696602
GO:0005886	Component	Plasma membrane	TAS	9153235
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	TAS	9153235
GO:0005911	Component	Cell-cell junction	IDA	25468996
GO:0005912	Component	Adherens junction	IDA	24046456
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007409	Process	Axonogenesis	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	23983584
GO:0016324	Component	Apical plasma membrane	IDA	23983584
GO:0016600	Component	Flotillin complex	IBA
GO:0016600	Component	Flotillin complex	IDA	21399631, 21696602, 24046456, 25204797
GO:0016600	Component	Flotillin complex	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0022617	Process	Extracellular matrix disassembly	IMP	21119006
GO:0030027	Component	Lamellipodium	IDA	24046456
GO:0030864	Component	Cortical actin cytoskeleton	IDA	24046456
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	23983584
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	IEA
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	ISS
GO:0034332	Process	Adherens junction organization	IMP	24046456
GO:0034451	Component	Centriolar satellite	IDA	18000879
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	23319823
GO:0044291	Component	Cell-cell contact zone	IDA	23983584
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0044854	Process	Plasma membrane raft assembly	IMP	21399631
GO:0044857	Process	Plasma membrane raft organization	IMP	25204797
GO:0045121	Component	Membrane raft	IDA	15469992, 25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0045807	Process	Positive regulation of endocytosis	IBA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	21399631
GO:0048643	Process	Positive regulation of skeletal muscle tissue development	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0051580	Process	Regulation of neurotransmitter uptake	IDA	21399631
GO:0051580	Process	Regulation of neurotransmitter uptake	IMP	21399631
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070836	Process	Caveola assembly	IMP	25204797
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IMP	24612608
GO:0098691	Component	Dopaminergic synapse	IDA	21399631
GO:0098691	Component	Dopaminergic synapse	IMP	21399631
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1901890	Process	Positive regulation of cell junction assembly	IBA
GO:1901890	Process	Positive regulation of cell junction assembly	IEA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IBA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA

MIM	HGNC	e!Ensembl
606998	3757	ENSG00000137312

O75955

Protein name

Flotillin-1

Protein function

May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.

PDB

9BQ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01145	Band_7	3 → 185	SPFH domain / Band 7 family	Family

Sequence

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Insulin signaling pathway		Synaptic adhesion-like molecules

FLOT1 (flotillin 1)