Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10205
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin protein zero like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MPZL2
Synonyms (NCBI Gene) Gene synonyms aliases
DFNB111, EVA, EVA1
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs146689036 G>A,T Pathogenic Coding sequence variant, stop gained, missense variant
rs752672077 T>- Pathogenic Frameshift variant, coding sequence variant
rs759432278 C>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1157289 hsa-miR-1226 CLIP-seq
MIRT1157290 hsa-miR-1264 CLIP-seq
MIRT1157291 hsa-miR-1273e CLIP-seq
MIRT1157292 hsa-miR-1283 CLIP-seq
MIRT1157293 hsa-miR-141 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21982860
GO:0005856 Component Cytoskeleton TAS 9585423
GO:0005886 Component Plasma membrane IBA
GO:0007155 Process Cell adhesion IEA
GO:0007156 Process Homophilic cell adhesion via plasma membrane adhesion molecules TAS 9585423
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604873 3496 ENSG00000149573
Protein
UniProt ID O60487
Protein name Myelin protein zero-like protein 2 (Epithelial V-like antigen 1)
Protein function Mediates homophilic cell-cell adhesion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 30 143 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. In fetal tissues, highest expression in the inner ear. In adult tissues, highest levels in thymus and lung. {ECO:0000269|PubMed:29961571}.
Sequence
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
YTCQVKNPPDVDGVIGEIRLSVV
HTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
KRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Sequence length 215
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hearing Loss Hearing loss, autosomal recessive 111, Hearing loss, autosomal recessive rs752672077, rs146689036, rs759432278 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 38254107
Breast Neoplasms Associate 28216417
Congenital Abnormalities Associate 38254107
Deafness Associate 32203226
Deafness Autosomal Recessive Associate 38254107
Glioblastoma Associate 35418162
Hearing Loss Associate 38254107
Hearing Loss Sensorineural Associate 38254107
Infections Associate 35403229
Leukemia Myeloid Acute Associate 35249471