Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	102
Gene name Gene Name - the full gene name approved by the HGNC.	ADAM metallopeptidase domain 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADAM10
Synonyms (NCBI Gene) Gene synonyms aliases	AD10, AD18, CD156c, CDw156, HsT18717, MADM, RAK, kuz
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AD18, RAK
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	Members of the ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. This gene encodes and ADAM family member that cleaves many proteins including TNF-alpha and E-cadherin. Alternate splicin

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61751103	C>G	Risk-factor	Missense variant, coding sequence variant
rs145518263	T>C	Risk-factor	Missense variant, coding sequence variant
rs483352912	G>A	Pathogenic	Coding sequence variant, missense variant
rs483352913	C>T	Pathogenic	Coding sequence variant, missense variant
rs483352914	A>T	Pathogenic	Coding sequence variant, stop gained
rs483352915	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs483352916	C>T	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(260)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004879	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	19726678
MIRT004879	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	19726678
MIRT021045	hsa-miR-155-5p	Proteomics	21030878
MIRT041888	hsa-miR-484	CLASH	23622248
MIRT728389	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT728388	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT728387	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT733467	hsa-miR-451a	Luciferase reporter assay, qRT-PCR, Western blot	25151965
MIRT004879	hsa-miR-122-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	25318895
MIRT004879	hsa-miR-122-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32512881
MIRT732711	hsa-miR-144-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32512881
MIRT733206	hsa-miR-155-3p	RNA-seq	32751854
MIRT733467	hsa-miR-451a	Western blotting, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR	32710569
MIRT736646	hsa-miR-365a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32284760
MIRT755737	hsa-miR-140-3p	Western blotting	38956605
MIRT765809	hsa-miR-1	CLIP-seq
MIRT765810	hsa-miR-1200	CLIP-seq
MIRT765811	hsa-miR-1227	CLIP-seq
MIRT765812	hsa-miR-1270	CLIP-seq
MIRT765813	hsa-miR-1272	CLIP-seq
MIRT765814	hsa-miR-1279	CLIP-seq
MIRT765815	hsa-miR-1283	CLIP-seq
MIRT765816	hsa-miR-1294	CLIP-seq
MIRT765817	hsa-miR-1302	CLIP-seq
MIRT765818	hsa-miR-143	CLIP-seq
MIRT765819	hsa-miR-15a	CLIP-seq
MIRT765820	hsa-miR-15b	CLIP-seq
MIRT765821	hsa-miR-16	CLIP-seq
MIRT765822	hsa-miR-186	CLIP-seq
MIRT765823	hsa-miR-195	CLIP-seq
MIRT765824	hsa-miR-206	CLIP-seq
MIRT765825	hsa-miR-2113	CLIP-seq
MIRT765826	hsa-miR-25	CLIP-seq
MIRT765827	hsa-miR-3133	CLIP-seq
MIRT765828	hsa-miR-3163	CLIP-seq
MIRT765829	hsa-miR-32	CLIP-seq
MIRT765830	hsa-miR-3201	CLIP-seq
MIRT765831	hsa-miR-323-5p	CLIP-seq
MIRT765832	hsa-miR-330-3p	CLIP-seq
MIRT765833	hsa-miR-3607-5p	CLIP-seq
MIRT765834	hsa-miR-3613-3p	CLIP-seq
MIRT765835	hsa-miR-3614-5p	CLIP-seq
MIRT765836	hsa-miR-363	CLIP-seq
MIRT765837	hsa-miR-3662	CLIP-seq
MIRT765838	hsa-miR-367	CLIP-seq
MIRT765839	hsa-miR-3673	CLIP-seq
MIRT765840	hsa-miR-3689a-5p	CLIP-seq
MIRT765841	hsa-miR-3689b	CLIP-seq
MIRT765842	hsa-miR-3689e	CLIP-seq
MIRT765843	hsa-miR-3689f	CLIP-seq
MIRT765844	hsa-miR-3942-3p	CLIP-seq
MIRT765845	hsa-miR-409-3p	CLIP-seq
MIRT765846	hsa-miR-424	CLIP-seq
MIRT765847	hsa-miR-4263	CLIP-seq
MIRT765848	hsa-miR-4275	CLIP-seq
MIRT765849	hsa-miR-4282	CLIP-seq
MIRT765850	hsa-miR-4298	CLIP-seq
MIRT765851	hsa-miR-4316	CLIP-seq
MIRT765852	hsa-miR-4324	CLIP-seq
MIRT765853	hsa-miR-4422	CLIP-seq
MIRT765854	hsa-miR-4432	CLIP-seq
MIRT765855	hsa-miR-4452	CLIP-seq
MIRT765856	hsa-miR-4524	CLIP-seq
MIRT765857	hsa-miR-4531	CLIP-seq
MIRT765858	hsa-miR-4652-3p	CLIP-seq
MIRT765859	hsa-miR-4659a-3p	CLIP-seq
MIRT765860	hsa-miR-4659a-5p	CLIP-seq
MIRT765861	hsa-miR-4659b-3p	CLIP-seq
MIRT765862	hsa-miR-4659b-5p	CLIP-seq
MIRT765863	hsa-miR-4683	CLIP-seq
MIRT765864	hsa-miR-4694-3p	CLIP-seq
MIRT765865	hsa-miR-4695-3p	CLIP-seq
MIRT765866	hsa-miR-4719	CLIP-seq
MIRT765867	hsa-miR-4770	CLIP-seq
MIRT765868	hsa-miR-4776-3p	CLIP-seq
MIRT765869	hsa-miR-4791	CLIP-seq
MIRT765870	hsa-miR-4803	CLIP-seq
MIRT765871	hsa-miR-494	CLIP-seq
MIRT765872	hsa-miR-496	CLIP-seq
MIRT765873	hsa-miR-497	CLIP-seq
MIRT765874	hsa-miR-499-5p	CLIP-seq
MIRT765875	hsa-miR-503	CLIP-seq
MIRT765876	hsa-miR-5096	CLIP-seq
MIRT765877	hsa-miR-513a-3p	CLIP-seq
MIRT765878	hsa-miR-515-5p	CLIP-seq
MIRT765879	hsa-miR-520d-5p	CLIP-seq
MIRT765880	hsa-miR-524-5p	CLIP-seq
MIRT765881	hsa-miR-544b	CLIP-seq
MIRT765882	hsa-miR-562	CLIP-seq
MIRT765883	hsa-miR-613	CLIP-seq
MIRT765884	hsa-miR-620	CLIP-seq
MIRT765885	hsa-miR-629	CLIP-seq
MIRT765886	hsa-miR-646	CLIP-seq
MIRT765887	hsa-miR-92a	CLIP-seq
MIRT765888	hsa-miR-92b	CLIP-seq
MIRT765814	hsa-miR-1279	CLIP-seq
MIRT765815	hsa-miR-1283	CLIP-seq
MIRT1925659	hsa-miR-140-5p	CLIP-seq
MIRT1925660	hsa-miR-145	CLIP-seq
MIRT765822	hsa-miR-186	CLIP-seq
MIRT1925661	hsa-miR-198	CLIP-seq
MIRT1925662	hsa-miR-2116	CLIP-seq
MIRT765826	hsa-miR-25	CLIP-seq
MIRT765829	hsa-miR-32	CLIP-seq
MIRT765830	hsa-miR-3201	CLIP-seq
MIRT1925663	hsa-miR-3545-5p	CLIP-seq
MIRT1925664	hsa-miR-3591-5p	CLIP-seq
MIRT765836	hsa-miR-363	CLIP-seq
MIRT765838	hsa-miR-367	CLIP-seq
MIRT1925665	hsa-miR-409-5p	CLIP-seq
MIRT1925666	hsa-miR-4460	CLIP-seq
MIRT1925667	hsa-miR-4503	CLIP-seq
MIRT765858	hsa-miR-4652-3p	CLIP-seq
MIRT765859	hsa-miR-4659a-3p	CLIP-seq
MIRT765860	hsa-miR-4659a-5p	CLIP-seq
MIRT765861	hsa-miR-4659b-3p	CLIP-seq
MIRT765862	hsa-miR-4659b-5p	CLIP-seq
MIRT1925668	hsa-miR-4677-5p	CLIP-seq
MIRT765865	hsa-miR-4695-3p	CLIP-seq
MIRT1925669	hsa-miR-4727-3p	CLIP-seq
MIRT765868	hsa-miR-4776-3p	CLIP-seq
MIRT765869	hsa-miR-4791	CLIP-seq
MIRT765871	hsa-miR-494	CLIP-seq
MIRT1925670	hsa-miR-507	CLIP-seq
MIRT1925671	hsa-miR-548n	CLIP-seq
MIRT1925672	hsa-miR-548t	CLIP-seq
MIRT1925673	hsa-miR-557	CLIP-seq
MIRT1925674	hsa-miR-590-3p	CLIP-seq
MIRT1925675	hsa-miR-602	CLIP-seq
MIRT1925676	hsa-miR-892a	CLIP-seq
MIRT765887	hsa-miR-92a	CLIP-seq
MIRT765888	hsa-miR-92b	CLIP-seq
MIRT2167043	hsa-miR-103a	CLIP-seq
MIRT2167044	hsa-miR-107	CLIP-seq
MIRT2167045	hsa-miR-1185	CLIP-seq
MIRT765812	hsa-miR-1270	CLIP-seq
MIRT765816	hsa-miR-1294	CLIP-seq
MIRT2167046	hsa-miR-1324	CLIP-seq
MIRT1925659	hsa-miR-140-5p	CLIP-seq
MIRT2167047	hsa-miR-1537	CLIP-seq
MIRT2167048	hsa-miR-182	CLIP-seq
MIRT2167049	hsa-miR-190	CLIP-seq
MIRT2167050	hsa-miR-190b	CLIP-seq
MIRT2167051	hsa-miR-2276	CLIP-seq
MIRT2167052	hsa-miR-2964a-5p	CLIP-seq
MIRT2167053	hsa-miR-3074-3p	CLIP-seq
MIRT2167054	hsa-miR-31	CLIP-seq
MIRT2167055	hsa-miR-3152-5p	CLIP-seq
MIRT2167056	hsa-miR-3185	CLIP-seq
MIRT765830	hsa-miR-3201	CLIP-seq
MIRT765831	hsa-miR-323-5p	CLIP-seq
MIRT2167057	hsa-miR-34a	CLIP-seq
MIRT2167058	hsa-miR-34c-5p	CLIP-seq
MIRT1925663	hsa-miR-3545-5p	CLIP-seq
MIRT1925664	hsa-miR-3591-5p	CLIP-seq
MIRT2167059	hsa-miR-3605-5p	CLIP-seq
MIRT2167060	hsa-miR-3614-3p	CLIP-seq
MIRT765835	hsa-miR-3614-5p	CLIP-seq
MIRT2167061	hsa-miR-361-5p	CLIP-seq
MIRT2167062	hsa-miR-3663-5p	CLIP-seq
MIRT2167063	hsa-miR-3679-5p	CLIP-seq
MIRT2167064	hsa-miR-3682-3p	CLIP-seq
MIRT2167065	hsa-miR-383	CLIP-seq
MIRT765845	hsa-miR-409-3p	CLIP-seq
MIRT1925665	hsa-miR-409-5p	CLIP-seq
MIRT2167066	hsa-miR-4276	CLIP-seq
MIRT765851	hsa-miR-4316	CLIP-seq
MIRT1925666	hsa-miR-4460	CLIP-seq
MIRT2167067	hsa-miR-4480	CLIP-seq
MIRT2167068	hsa-miR-449b	CLIP-seq
MIRT2167069	hsa-miR-451	CLIP-seq
MIRT2167070	hsa-miR-4527	CLIP-seq
MIRT765857	hsa-miR-4531	CLIP-seq
MIRT2167071	hsa-miR-4649-3p	CLIP-seq
MIRT765859	hsa-miR-4659a-3p	CLIP-seq
MIRT765860	hsa-miR-4659a-5p	CLIP-seq
MIRT765861	hsa-miR-4659b-3p	CLIP-seq
MIRT765862	hsa-miR-4659b-5p	CLIP-seq
MIRT2167072	hsa-miR-4680-5p	CLIP-seq
MIRT2167073	hsa-miR-4714-5p	CLIP-seq
MIRT1925669	hsa-miR-4727-3p	CLIP-seq
MIRT2167074	hsa-miR-4728-3p	CLIP-seq
MIRT2167075	hsa-miR-4763-5p	CLIP-seq
MIRT2167076	hsa-miR-4772-5p	CLIP-seq
MIRT2167077	hsa-miR-4773	CLIP-seq
MIRT2167078	hsa-miR-4774-3p	CLIP-seq
MIRT765868	hsa-miR-4776-3p	CLIP-seq
MIRT765869	hsa-miR-4791	CLIP-seq
MIRT765870	hsa-miR-4803	CLIP-seq
MIRT2167079	hsa-miR-509-3p	CLIP-seq
MIRT765878	hsa-miR-515-5p	CLIP-seq
MIRT2167080	hsa-miR-548ac	CLIP-seq
MIRT2167081	hsa-miR-548d-3p	CLIP-seq
MIRT2167082	hsa-miR-548z	CLIP-seq
MIRT2167083	hsa-miR-570	CLIP-seq
MIRT1925675	hsa-miR-602	CLIP-seq
MIRT765884	hsa-miR-620	CLIP-seq
MIRT765885	hsa-miR-629	CLIP-seq
MIRT2167084	hsa-miR-891a	CLIP-seq
MIRT2469512	hsa-miR-122	CLIP-seq
MIRT765812	hsa-miR-1270	CLIP-seq
MIRT765813	hsa-miR-1272	CLIP-seq
MIRT765816	hsa-miR-1294	CLIP-seq
MIRT765818	hsa-miR-143	CLIP-seq
MIRT765826	hsa-miR-25	CLIP-seq
MIRT2469513	hsa-miR-3198	CLIP-seq
MIRT765829	hsa-miR-32	CLIP-seq
MIRT2469514	hsa-miR-320a	CLIP-seq
MIRT2469515	hsa-miR-320b	CLIP-seq
MIRT2469516	hsa-miR-320c	CLIP-seq
MIRT2469517	hsa-miR-320d	CLIP-seq
MIRT2469518	hsa-miR-3622a-5p	CLIP-seq
MIRT765836	hsa-miR-363	CLIP-seq
MIRT765838	hsa-miR-367	CLIP-seq
MIRT2469519	hsa-miR-4309	CLIP-seq
MIRT765851	hsa-miR-4316	CLIP-seq
MIRT2469520	hsa-miR-4423-3p	CLIP-seq
MIRT2469521	hsa-miR-4429	CLIP-seq
MIRT2469522	hsa-miR-4446-5p	CLIP-seq
MIRT2469523	hsa-miR-4464	CLIP-seq
MIRT2469524	hsa-miR-4476	CLIP-seq
MIRT765857	hsa-miR-4531	CLIP-seq
MIRT2469525	hsa-miR-4670-3p	CLIP-seq
MIRT765863	hsa-miR-4683	CLIP-seq
MIRT2469526	hsa-miR-4748	CLIP-seq
MIRT2469527	hsa-miR-4753-3p	CLIP-seq
MIRT2469528	hsa-miR-4768-5p	CLIP-seq
MIRT765867	hsa-miR-4770	CLIP-seq
MIRT2469529	hsa-miR-548b-3p	CLIP-seq
MIRT765884	hsa-miR-620	CLIP-seq
MIRT765885	hsa-miR-629	CLIP-seq
MIRT2469530	hsa-miR-633	CLIP-seq
MIRT2469531	hsa-miR-9	CLIP-seq
MIRT765887	hsa-miR-92a	CLIP-seq
MIRT765888	hsa-miR-92b	CLIP-seq
MIRT2469512	hsa-miR-122	CLIP-seq
MIRT765812	hsa-miR-1270	CLIP-seq
MIRT765813	hsa-miR-1272	CLIP-seq
MIRT765816	hsa-miR-1294	CLIP-seq
MIRT765818	hsa-miR-143	CLIP-seq
MIRT2469513	hsa-miR-3198	CLIP-seq
MIRT2469518	hsa-miR-3622a-5p	CLIP-seq
MIRT2469519	hsa-miR-4309	CLIP-seq
MIRT765851	hsa-miR-4316	CLIP-seq
MIRT2469520	hsa-miR-4423-3p	CLIP-seq
MIRT2469522	hsa-miR-4446-5p	CLIP-seq
MIRT2469523	hsa-miR-4464	CLIP-seq
MIRT2469524	hsa-miR-4476	CLIP-seq
MIRT765857	hsa-miR-4531	CLIP-seq
MIRT2469525	hsa-miR-4670-3p	CLIP-seq
MIRT765863	hsa-miR-4683	CLIP-seq
MIRT2469526	hsa-miR-4748	CLIP-seq
MIRT2469527	hsa-miR-4753-3p	CLIP-seq
MIRT2469528	hsa-miR-4768-5p	CLIP-seq
MIRT765867	hsa-miR-4770	CLIP-seq
MIRT2469529	hsa-miR-548b-3p	CLIP-seq
MIRT765884	hsa-miR-620	CLIP-seq
MIRT765885	hsa-miR-629	CLIP-seq
MIRT2469530	hsa-miR-633	CLIP-seq
MIRT2469531	hsa-miR-9	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
PAX2	Unknown	21876729;21880579
SP1	Activation	21854868

Show/Hide all(96)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0004175	Function	Endopeptidase activity	IMP	24990881, 28855301, 29430990
GO:0004175	Function	Endopeptidase activity	ISS
GO:0004222	Function	Metalloendopeptidase activity	IBA	21873635
GO:0004222	Function	Metalloendopeptidase activity	IDA	18676862
GO:0004222	Function	Metalloendopeptidase activity	IMP	19114711
GO:0004222	Function	Metalloendopeptidase activity	ISS
GO:0004222	Function	Metalloendopeptidase activity	NAS	8694785
GO:0005102	Function	Signaling receptor binding	NAS	12176995
GO:0005178	Function	Integrin binding	NAS	8694785
GO:0005515	Function	Protein binding	IPI	10527948, 15280379, 17301176, 19587294, 20624979, 23091066, 23289620, 23676497, 25036101, 26686862, 30312582, 30463011, 30538620, 32814053, 32900848
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	12475894
GO:0005798	Component	Golgi-associated vesicle	IDA	12475894
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IMP	20624979, 28164773
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006509	Process	Membrane protein ectodomain proteolysis	IBA	21873635
GO:0006509	Process	Membrane protein ectodomain proteolysis	IDA	12714508, 17557115, 18355449, 18419754, 18676862, 19114711
GO:0006509	Process	Membrane protein ectodomain proteolysis	IMP	17965014, 18355445, 18373975, 20711474, 24990881, 28164773, 28855301, 29430990
GO:0007162	Process	Negative regulation of cell adhesion	IDA	12714508
GO:0007162	Process	Negative regulation of cell adhesion	NAS	8694785
GO:0007219	Process	Notch signaling pathway	IBA	21873635
GO:0007219	Process	Notch signaling pathway	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	8694785
GO:0007267	Process	Cell-cell signaling	NAS	12714508
GO:0007283	Process	Spermatogenesis	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	12475894
GO:0008237	Function	Metallopeptidase activity	IMP	12535668
GO:0008237	Function	Metallopeptidase activity	TAS
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18373975
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	29693139
GO:0008593	Process	Regulation of Notch signaling pathway	IEA
GO:0009986	Component	Cell surface	IDA	12475894, 23035126, 23091066
GO:0010629	Process	Negative regulation of gene expression	IMP	24530397
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	18373975
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	NAS	8694785
GO:0016485	Process	Protein processing	ISS
GO:0017124	Function	SH3 domain binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	18373975
GO:0030335	Process	Positive regulation of cell migration	IMP	18373975
GO:0030424	Component	Axon	IEA
GO:0034205	Process	Amyloid-beta formation	IEA
GO:0034332	Process	Adherens junction organization	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	11831872
GO:0035333	Process	Notch receptor processing, ligand-dependent	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0042117	Process	Monocyte activation	IMP	11831872
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042987	Process	Amyloid precursor protein catabolic process	IMP	28164773
GO:0042987	Process	Amyloid precursor protein catabolic process	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	29693139
GO:0043197	Component	Dendritic spine	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046930	Component	Pore complex	IMP	30463011
GO:0046931	Process	Pore complex assembly	IMP	30463011
GO:0051089	Process	Constitutive protein ectodomain proteolysis	IDA	12714508
GO:0061001	Process	Regulation of dendritic spine morphogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071157	Process	Negative regulation of cell cycle arrest	TAS	29693139
GO:0090102	Process	Cochlea development	IEA
GO:0097038	Component	Perinuclear endoplasmic reticulum	IDA	23091066
GO:0097060	Component	Synaptic membrane	IBA	21873635
GO:0097060	Component	Synaptic membrane	IDA	23676497
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	23035126
GO:0097327	Process	Response to antineoplastic agent	IEA
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099173	Process	Postsynapse organization	IEA
GO:1901342	Process	Regulation of vasculature development	IEA
GO:1901998	Process	Toxin transport	IMP	20624979
GO:1902945	Function	Metalloendopeptidase activity involved in amyloid precursor protein catabolic process	IBA	21873635
GO:1902945	Function	Metalloendopeptidase activity involved in amyloid precursor protein catabolic process	IMP	28164773
GO:1902945	Function	Metalloendopeptidase activity involved in amyloid precursor protein catabolic process	ISS

MIM	HGNC	e!Ensembl
602192	188	ENSG00000137845

Protein

UniProt ID

O14672

Protein name

Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24.81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c)

Protein function

Transmembrane metalloprotease which mediates the ectodomain shedding of a myriad of transmembrane proteins, including adhesion proteins, growth factor precursors and cytokines being essential for development and tissue homeostasis (PubMed:117869

PDB

6BDZ , 6BE6 , 8ESV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	27 → 156	Reprolysin family propeptide	Family
PF13574	Reprolysin_2	239 → 446		Domain
PF00200	Disintegrin	466 → 546	Disintegrin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain (at protein level) (PubMed:23676497). Expressed in spleen, lymph node, thymus, peripheral blood leukocyte, bone marrow, cartilage, chondrocytes and fetal liver (PubMed:11511685, PubMed:9016778). {ECO:0000269|PubM

Sequence

MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR

Sequence length

748

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Alzheimer disease Epithelial cell signaling in Helicobacter pylori infection		Degradation of the extracellular matrix Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 t(7;9)(NOTCH1:M1580_K2555) Translocation Mutant Constitutive Signaling by NOTCH1 HD Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Neutrophil degranulation Post-translational protein phosphorylation NOTCH3 Activation and Transmission of Signal to the Nucleus Amyloid fiber formation

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset, ALZHEIMER DISEASE 18	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	30820047, 30617256, 19608551, 24055016
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	16583263
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	16583263
Dowling-degos disease	dowling-degos disease, Dowling-Degos disease 1	rs398123038, rs886041033, rs587777293, rs587777294, rs587777295, rs587777296, rs1569152303
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	16583263
Reticulate acropigmentation of kitamura	Reticulate acropigmentation of Kitamura	rs483352913, rs483352914, rs483352915, rs483352916	23666529
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	28991256, 30285260

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (85)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	30786875
Alzheimer Disease	Associate	19183255, 19221430, 21196064, 22572541, 22594617, 23546882, 26343025, 29253717, 29777097, 29988083, 31843015, 33129344, 33152005, 35705192, 36411364, 37047093, 37959001 View all (2 more)
Alzheimer Disease	Inhibit	26555131, 33731436
Amyloidosis	Associate	33419465
Arthritis Rheumatoid	Associate	15880344
Ascites	Associate	30678441
Atherosclerosis	Associate	23773531, 35705192
Autoimmune Diseases	Associate	33152005
Blister	Associate	18200054
Breast Neoplasms	Associate	16627989, 19603142, 19783906, 26284334, 32782317
Carcinogenesis	Inhibit	19783906
Carcinoma Hepatocellular	Associate	22581584, 23936798, 24670536, 27259866, 30275760, 33206588, 36708563, 37530332
Carcinoma Hepatocellular	Stimulate	39346916
Carcinoma Merkel Cell	Stimulate	30188954
Carcinoma Pancreatic Ductal	Associate	27602753
CD59 Deficiency	Associate	36768791
Cell Transformation Neoplastic	Associate	36293469
Cerebrovascular Disorders	Associate	35609807
Cholangiocarcinoma	Associate	35223192
Cognition Disorders	Associate	33942972, 36229517
Colorectal Neoplasms	Associate	16207476, 27517630
COVID 19	Associate	32581077, 35708281, 36229517, 40141308
Dementia	Associate	31836585
Dermatomyositis	Associate	36768791
Diabetes Mellitus	Associate	26325204
Diabetes Mellitus	Stimulate	35705192
Diabetes Mellitus Type 1	Associate	26325204
Diabetes Mellitus Type 2	Associate	35705192
Diabetic Nephropathies	Associate	26990852
Disease	Associate	36229517
Down Syndrome	Associate	31843015
Drug Related Side Effects and Adverse Reactions	Associate	34789642
Dry Eye Syndromes	Associate	36499565
Eczema	Associate	18200054
Frontotemporal Dementia	Associate	33152005
Glioblastoma	Associate	19357285, 27541285, 31142630
Glioma	Associate	19357285
Glomerulonephritis Membranous	Associate	19435795
Hodgkin Disease	Associate	22167753
Hypertrophy	Associate	33416124
Hypoxia	Stimulate	31402756
Inflammation	Associate	25888255, 31780861, 32581077, 34880199, 35199397, 35705192
Intracranial Arteriosclerosis	Associate	23773531
Kidney Diseases	Associate	19435795
Leukemia	Stimulate	19783906
Liver Cirrhosis	Associate	19432809
Liver Diseases	Associate	19432809
Liver Neoplasms	Associate	22594617
Lymphatic Metastasis	Stimulate	28656294
Lymphatic Metastasis	Associate	30275760, 35771404
Melanoma	Associate	18971959, 19434087, 19865098, 21876729, 23317503, 26266086
Mouth Neoplasms	Associate	29895129
Multiple Myeloma	Associate	26071561
Nasal Polyps	Associate	29484441
Nasopharyngeal Carcinoma	Stimulate	26310711
Neoplasm Metastasis	Stimulate	19865098, 29895129
Neoplasm Metastasis	Associate	21876729, 23936798, 24670536, 26310711, 26440150, 30275760
Neoplasms	Associate	16207476, 22581584, 23317503, 24130797, 24670536, 26266086, 26284334, 26440150, 27517630, 27541285, 27628319, 28656294, 30188954, 30275760, 30661303 View all (6 more)
Neoplasms	Stimulate	19783906, 24935471, 26310711, 29776401
Neoplasms	Inhibit	27526672
Neoplasms Glandular and Epithelial	Associate	27517630
Neurodegenerative Diseases	Associate	29777097, 36229517
Neurotoxicity Syndromes	Associate	29253717
Osteosarcoma	Associate	24548763
Ovarian Neoplasms	Associate	24518602, 28232483, 30792527, 36922678
Pancreatic Neoplasms	Associate	24625754, 26440150, 31402756
Plaque Amyloid	Associate	22572541, 31843015
Pre Eclampsia	Associate	21402705
Pre Eclampsia	Stimulate	25031267
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21625236
Prostatic Neoplasms	Associate	30974114
Retinoblastoma	Associate	36293469
Schizophrenia	Associate	33070392, 35163460
Sepsis	Associate	25888255, 31780861
Severe Acute Respiratory Syndrome	Associate	25888255
Shock	Associate	25888255
Sick Sinus Syndrome	Stimulate	36171622
Smooth Muscle Tumor	Associate	34880199
Squamous Cell Carcinoma of Head and Neck	Associate	24055471, 25333745, 28656294, 29895129, 35771404, 36946281
Squamous Cell Carcinoma of Head and Neck	Inhibit	27628319
Stomach Neoplasms	Associate	26852749, 36171622
Tauopathies	Associate	33419465
Triple Negative Breast Neoplasms	Associate	31786854, 31796994
Urinary Bladder Neoplasms	Associate	24935471
Wounds and Injuries	Associate	34789642

ADAM10 (ADAM metallopeptidase domain 10)