Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10196
Gene name	Protein arginine methyltransferase 3
Gene symbol	PRMT3
Synonyms (NCBI Gene)	HRMT1L3
Chromosome	11
Chromosome location	11p15.1
Summary	This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044363	hsa-miR-106b-5p	CLASH	23622248
MIRT038276	hsa-miR-361-3p	CLASH	23622248
MIRT052756	hsa-miR-1260b	CLASH	23622248
MIRT498366	hsa-miR-4717-5p	PAR-CLIP	22291592
MIRT498365	hsa-miR-15a-3p	PAR-CLIP	22291592
MIRT498364	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT498363	hsa-miR-4495	PAR-CLIP	22291592
MIRT498362	hsa-miR-6515-3p	PAR-CLIP	22291592
MIRT498361	hsa-miR-1236-3p	PAR-CLIP	22291592
MIRT498360	hsa-miR-5704	PAR-CLIP	22291592
MIRT497670	hsa-miR-1295b-5p	PAR-CLIP	22291592
MIRT497669	hsa-miR-1912	PAR-CLIP	22291592
MIRT497668	hsa-miR-3130-5p	PAR-CLIP	22291592
MIRT497667	hsa-miR-4482-5p	PAR-CLIP	22291592
MIRT497666	hsa-miR-5693	PAR-CLIP	22291592
MIRT497665	hsa-miR-6499-3p	PAR-CLIP	22291592
MIRT497664	hsa-miR-3135b	PAR-CLIP	22291592
MIRT497663	hsa-miR-504-3p	PAR-CLIP	22291592
MIRT497662	hsa-miR-122-5p	PAR-CLIP	22291592
MIRT497661	hsa-miR-564	PAR-CLIP	22291592
MIRT497660	hsa-miR-3652	PAR-CLIP	22291592
MIRT497659	hsa-miR-4430	PAR-CLIP	22291592
MIRT497658	hsa-miR-143-5p	PAR-CLIP	22291592
MIRT497657	hsa-miR-891a-3p	PAR-CLIP	22291592
MIRT497655	hsa-miR-5591-3p	PAR-CLIP	22291592
MIRT497656	hsa-miR-5698	PAR-CLIP	22291592
MIRT498366	hsa-miR-4717-5p	PAR-CLIP	22291592
MIRT498365	hsa-miR-15a-3p	PAR-CLIP	22291592
MIRT498364	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT498363	hsa-miR-4495	PAR-CLIP	22291592
MIRT498362	hsa-miR-6515-3p	PAR-CLIP	22291592
MIRT498361	hsa-miR-1236-3p	PAR-CLIP	22291592
MIRT498360	hsa-miR-5704	PAR-CLIP	22291592
MIRT497670	hsa-miR-1295b-5p	PAR-CLIP	22291592
MIRT497669	hsa-miR-1912	PAR-CLIP	22291592
MIRT497668	hsa-miR-3130-5p	PAR-CLIP	22291592
MIRT497667	hsa-miR-4482-5p	PAR-CLIP	22291592
MIRT497666	hsa-miR-5693	PAR-CLIP	22291592
MIRT497665	hsa-miR-6499-3p	PAR-CLIP	22291592
MIRT497664	hsa-miR-3135b	PAR-CLIP	22291592
MIRT497663	hsa-miR-504-3p	PAR-CLIP	22291592
MIRT497662	hsa-miR-122-5p	PAR-CLIP	22291592
MIRT497661	hsa-miR-564	PAR-CLIP	22291592
MIRT497660	hsa-miR-3652	PAR-CLIP	22291592
MIRT497659	hsa-miR-4430	PAR-CLIP	22291592
MIRT497658	hsa-miR-143-5p	PAR-CLIP	22291592
MIRT497657	hsa-miR-891a-3p	PAR-CLIP	22291592
MIRT497655	hsa-miR-5591-3p	PAR-CLIP	22291592
MIRT497656	hsa-miR-5698	PAR-CLIP	22291592
MIRT1264606	hsa-miR-203	CLIP-seq
MIRT1264607	hsa-miR-1283	CLIP-seq
MIRT1264608	hsa-miR-146a	CLIP-seq
MIRT1264609	hsa-miR-146b-5p	CLIP-seq
MIRT1264610	hsa-miR-300	CLIP-seq
MIRT1264611	hsa-miR-3646	CLIP-seq
MIRT1264612	hsa-miR-3662	CLIP-seq
MIRT1264613	hsa-miR-3671	CLIP-seq
MIRT1264614	hsa-miR-381	CLIP-seq
MIRT1264615	hsa-miR-4521	CLIP-seq
MIRT1264616	hsa-miR-4666-3p	CLIP-seq
MIRT1264617	hsa-miR-4698	CLIP-seq
MIRT1264618	hsa-miR-4719	CLIP-seq
MIRT1264619	hsa-miR-4762-5p	CLIP-seq
MIRT1264620	hsa-miR-4789-5p	CLIP-seq
MIRT1264621	hsa-miR-4793-5p	CLIP-seq
MIRT1264622	hsa-miR-548p	CLIP-seq
MIRT1264623	hsa-miR-556-3p	CLIP-seq
MIRT1264624	hsa-miR-583	CLIP-seq
MIRT1264625	hsa-miR-589	CLIP-seq
MIRT1264626	hsa-miR-590-3p	CLIP-seq
MIRT1264627	hsa-miR-607	CLIP-seq
MIRT1920821	hsa-miR-1224-5p	CLIP-seq
MIRT1264608	hsa-miR-146a	CLIP-seq
MIRT1264609	hsa-miR-146b-5p	CLIP-seq
MIRT1920822	hsa-miR-2467-5p	CLIP-seq
MIRT1920823	hsa-miR-3150b-3p	CLIP-seq
MIRT1920824	hsa-miR-3915	CLIP-seq
MIRT1920825	hsa-miR-4461	CLIP-seq
MIRT1920826	hsa-miR-4496	CLIP-seq
MIRT1920827	hsa-miR-4689	CLIP-seq
MIRT1920828	hsa-miR-4695-5p	CLIP-seq
MIRT1920829	hsa-miR-4768-5p	CLIP-seq
MIRT1920830	hsa-miR-4784	CLIP-seq
MIRT1264625	hsa-miR-589	CLIP-seq
MIRT1920831	hsa-miR-942	CLIP-seq
MIRT1920821	hsa-miR-1224-5p	CLIP-seq
MIRT1264608	hsa-miR-146a	CLIP-seq
MIRT1264609	hsa-miR-146b-5p	CLIP-seq
MIRT1920822	hsa-miR-2467-5p	CLIP-seq
MIRT1920823	hsa-miR-3150b-3p	CLIP-seq
MIRT1920824	hsa-miR-3915	CLIP-seq
MIRT1920825	hsa-miR-4461	CLIP-seq
MIRT1920826	hsa-miR-4496	CLIP-seq
MIRT1920827	hsa-miR-4689	CLIP-seq
MIRT1920828	hsa-miR-4695-5p	CLIP-seq
MIRT1920829	hsa-miR-4768-5p	CLIP-seq
MIRT1920830	hsa-miR-4784	CLIP-seq
MIRT1264625	hsa-miR-589	CLIP-seq
MIRT1920831	hsa-miR-942	CLIP-seq
MIRT1920821	hsa-miR-1224-5p	CLIP-seq
MIRT1264608	hsa-miR-146a	CLIP-seq
MIRT1264609	hsa-miR-146b-5p	CLIP-seq
MIRT1920822	hsa-miR-2467-5p	CLIP-seq
MIRT1920823	hsa-miR-3150b-3p	CLIP-seq
MIRT1920824	hsa-miR-3915	CLIP-seq
MIRT1920825	hsa-miR-4461	CLIP-seq
MIRT1920826	hsa-miR-4496	CLIP-seq
MIRT1920827	hsa-miR-4689	CLIP-seq
MIRT1920828	hsa-miR-4695-5p	CLIP-seq
MIRT1920829	hsa-miR-4768-5p	CLIP-seq
MIRT1920830	hsa-miR-4784	CLIP-seq
MIRT1264625	hsa-miR-589	CLIP-seq
MIRT1920831	hsa-miR-942	CLIP-seq
MIRT1264612	hsa-miR-3662	CLIP-seq
MIRT1264618	hsa-miR-4719	CLIP-seq
MIRT2601207	hsa-miR-1285	CLIP-seq
MIRT2601208	hsa-miR-1343	CLIP-seq
MIRT1264606	hsa-miR-203	CLIP-seq
MIRT2601209	hsa-miR-28-3p	CLIP-seq
MIRT2601210	hsa-miR-3074-5p	CLIP-seq
MIRT2601211	hsa-miR-3187-5p	CLIP-seq
MIRT1264615	hsa-miR-4521	CLIP-seq
MIRT2601212	hsa-miR-4640-3p	CLIP-seq
MIRT1264618	hsa-miR-4719	CLIP-seq
MIRT2601213	hsa-miR-4760-5p	CLIP-seq
MIRT2601214	hsa-miR-548ac	CLIP-seq
MIRT2601215	hsa-miR-548ae	CLIP-seq
MIRT2601216	hsa-miR-548aj	CLIP-seq
MIRT2601217	hsa-miR-548am	CLIP-seq
MIRT2601218	hsa-miR-548d-3p	CLIP-seq
MIRT2601219	hsa-miR-548x	CLIP-seq
MIRT2601220	hsa-miR-548z	CLIP-seq
MIRT1264624	hsa-miR-583	CLIP-seq
MIRT2601221	hsa-miR-612	CLIP-seq
MIRT2601222	hsa-miR-624	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18573314, 24981860, 25737013, 32296183, 33495566, 33961781, 39513743
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	39513743
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	33495566
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	9642256
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0008168	Function	Methyltransferase activity	IDA	18573314
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IBA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	NAS	9642256
GO:0016274	Function	Protein-arginine N-methyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	18573314
GO:0032259	Process	Methylation	IEA
GO:0035241	Function	Protein-arginine omega-N monomethyltransferase activity	IEA
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IEA
GO:0042054	Function	Histone methyltransferase activity	IBA
GO:0044020	Function	Histone H4R3 methyltransferase activity	IDA	39513743
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	31378783
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IMP	31378783
GO:0046872	Function	Metal ion binding	IEA
GO:1900053	Process	Negative regulation of retinoic acid biosynthetic process	IMP	33495566

MIM	HGNC	e!Ensembl
603190	30163	ENSG00000185238

O60678

Protein name

Protein arginine N-methyltransferase 3 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3)

Protein function

Protein-arginine N-methyltransferase that catalyzes both the monomethylation and asymmetric dimethylation of the guanidino nitrogens of arginine residues in target proteins, and therefore falls into the group of type I methyltransferases (PubMed

PDB

2FYT , 3SMQ , 4HSG , 4QQN , 4RYL , 8G2F , 8G2G , 8SHB , 8SHR , 8SIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06325	PrmA	248 → 347		Family

Sequence

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ

Sequence length

531

Interactions

View interactions

	Reactome
			RMTs methylate histone arginines Protein methylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	37024475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	37973560	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Associate	16190779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Associate	28408707	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRMT3 (protein arginine methyltransferase 3)