C5orf67 (chromosome 5 putative open reading frame 67)

Gene Gene information from NCBI Gene database.
Gene Other IDs Protein
Entrez ID 101928448
Gene name Chromosome 5 putative open reading frame 67
Gene symbol C5orf67
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5q11.2
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Other IDs Protein
MIM HGNC e!Ensembl
HGNC 51252 N/A
Protein Protein information from UniProt database.
Gene Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
F2Z3F1
Protein name Uncharacterized protein C5orf67
Family and domains
Sequence 
MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMM
PGAWTKLPGDGGSVPEKGKHGILGAQGQEHPGLNVSSPFSSPWTCYLSGHQPQNNNSPEL
QVKEILL
Sequence length 127
Interactions View interactions