TXNDC9 (thioredoxin domain containing 9)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 10190
Gene name Thioredoxin domain containing 9
Gene symbol TXNDC9
Synonyms (NCBI Gene)
APACDPHLP3
Chromosome 2
Chromosome location 2q11.2
Summary The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT1465242 hsa-miR-300 CLIP-seq
MIRT1465243 hsa-miR-381 CLIP-seq
MIRT2360552 hsa-miR-3160-5p CLIP-seq
MIRT2360553 hsa-miR-4642 CLIP-seq
MIRT2360554 hsa-miR-4698 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0005515 Function Protein binding IPI 16169070, 21516116, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
612564 24110 ENSG00000115514
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14530
Protein name Thioredoxin domain-containing protein 9 (ATP-binding protein associated with cell differentiation) (Protein 1-4)
Protein function Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00085 Thioredoxin 75 → 172 Thioredoxin Domain
Sequence 
MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQ
QKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLE
TKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLG
SSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Sequence length 226
Interactions View interactions