Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10190
Gene name Gene Name - the full gene name approved by the HGNC.
Thioredoxin domain containing 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TXNDC9
Synonyms (NCBI Gene) Gene synonyms aliases
APACD, PHLP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1465242 hsa-miR-300 CLIP-seq
MIRT1465243 hsa-miR-381 CLIP-seq
MIRT2360552 hsa-miR-3160-5p CLIP-seq
MIRT2360553 hsa-miR-4642 CLIP-seq
MIRT2360554 hsa-miR-4698 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0005515 Function Protein binding IPI 16169070, 21516116, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612564 24110 ENSG00000115514
Protein
UniProt ID O14530
Protein name Thioredoxin domain-containing protein 9 (ATP-binding protein associated with cell differentiation) (Protein 1-4)
Protein function Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00085 Thioredoxin 75 172 Thioredoxin Domain
Sequence
MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQ
QKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLE
TKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTT
ETLEWRLG
SSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Sequence length 226
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35485284
Carcinoma Hepatocellular Stimulate 30382079
Carcinoma Squamous Cell Associate 37303736
Lung Neoplasms Stimulate 35485284
Trisomy 18 Syndrome Associate 19108832