Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1018
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDK3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the r

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053431	hsa-miR-512-5p	Microarray	23807165
MIRT731162	hsa-miR-873-5p	5.0	25531331
MIRT731162	hsa-miR-873-5p	5.0	25531331
MIRT881138	hsa-miR-1302	CLIP-seq
MIRT881139	hsa-miR-3122	CLIP-seq
MIRT881140	hsa-miR-3199	CLIP-seq
MIRT881141	hsa-miR-3545-3p	CLIP-seq
MIRT881142	hsa-miR-3646	CLIP-seq
MIRT881143	hsa-miR-3913-5p	CLIP-seq
MIRT881144	hsa-miR-4298	CLIP-seq
MIRT881145	hsa-miR-4539	CLIP-seq
MIRT881146	hsa-miR-4724-5p	CLIP-seq
MIRT881147	hsa-miR-4740-5p	CLIP-seq
MIRT1961005	hsa-miR-1292	CLIP-seq
MIRT1961006	hsa-miR-1343	CLIP-seq
MIRT1961007	hsa-miR-1976	CLIP-seq
MIRT1961008	hsa-miR-4267	CLIP-seq
MIRT1961009	hsa-miR-450b-3p	CLIP-seq
MIRT1961010	hsa-miR-4713-3p	CLIP-seq
MIRT1961011	hsa-miR-638	CLIP-seq
MIRT1961012	hsa-miR-769-3p	CLIP-seq
MIRT1961005	hsa-miR-1292	CLIP-seq
MIRT1961006	hsa-miR-1343	CLIP-seq
MIRT1961007	hsa-miR-1976	CLIP-seq
MIRT1961008	hsa-miR-4267	CLIP-seq
MIRT1961009	hsa-miR-450b-3p	CLIP-seq
MIRT1961010	hsa-miR-4713-3p	CLIP-seq
MIRT1961011	hsa-miR-638	CLIP-seq
MIRT1961012	hsa-miR-769-3p	CLIP-seq
MIRT2385859	hsa-miR-1207-3p	CLIP-seq
MIRT2385860	hsa-miR-1827	CLIP-seq
MIRT2385861	hsa-miR-3612	CLIP-seq
MIRT2385862	hsa-miR-4731-5p	CLIP-seq
MIRT2385863	hsa-miR-486-3p	CLIP-seq
MIRT2385864	hsa-miR-646	CLIP-seq
MIRT2385865	hsa-miR-650	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8846921
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15084261, 22939624, 23602568, 24218572, 25344755, 28514442, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	24550317
GO:0008283	Process	Cell population proliferation	TAS	18794154
GO:0045023	Process	G0 to G1 transition	TAS	15084261
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA

MIM	HGNC	e!Ensembl
123828	1772	ENSG00000250506

Protein

UniProt ID

Q00526

Protein name

Cyclin-dependent kinase 3 (EC 2.7.11.22) (Cell division protein kinase 3)

Protein function

Serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle; involved in G0-G1 and G1-S cell cycle transitions. Interacts with CCNC/cyclin-C during interphase. Phosphorylates histone H1, ATF1, RB1 and C

PDB

7XQK , 8H4R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 286	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in cancer cell lines and glioblastoma tissue. {ECO:0000269|PubMed:18794154}.

Sequence

MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH

Sequence length

305

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Glioblastoma	Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypothyroidism	Hypothyroidism			GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	32444848
Carcinoma Non Small Cell Lung	Associate	40682474
Colorectal Neoplasms	Associate	33733923
Esophageal Squamous Cell Carcinoma	Associate	33504681
Glioblastoma	Associate	38014992
Hypoxia Brain	Associate	36077517
Neoplasms	Associate	32444848
Pancreatic Neoplasms	Associate	37198697

CDK3 (cyclin dependent kinase 3)