Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10179
Gene name Gene Name - the full gene name approved by the HGNC.
RNA binding motif protein 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBM7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045565 hsa-miR-149-5p CLASH 23622248
MIRT546799 hsa-miR-3908 PAR-CLIP 21572407
MIRT546798 hsa-miR-875-5p PAR-CLIP 21572407
MIRT546797 hsa-miR-410-3p PAR-CLIP 21572407
MIRT546796 hsa-miR-5009-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA 21873635
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 25578728, 30824372
GO:0003723 Function RNA binding IMP 25189701
GO:0003727 Function Single-stranded RNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612413 9904 ENSG00000076053
Protein
UniProt ID Q9Y580
Protein name RNA-binding protein 7 (RNA-binding motif protein 7)
Protein function RNA-binding subunit of the trimeric nuclear exosome targeting (NEXT) complex, a complex that functions as an RNA exosome cofactor that directs a subset of non-coding short-lived RNAs for exosomal degradation (PubMed:25189701, PubMed:25525152, Pu
PDB 2M8H , 5IQQ , 5LXR , 5LXY , 7S7B , 7S7C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 81 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHE
VSVPYAMNLLNGIKLYGRPIK
IQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERT
MDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHS
FNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDR
NHDDWSHDYDNRRDSSRDGKWRSSRH
Sequence length 266
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
15496427
Associations from Text Mining
Disease Name Relationship Type References
Leukemia Myeloid Acute Associate 34343137