ZNF256 (zinc finger protein 256)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10172
Gene name Zinc finger protein 256
Gene symbol ZNF256
Synonyms (NCBI Gene)
BMZF-3BMZF3
Chromosome 19
Chromosome location 19q13.43
miRNA miRNA information provided by mirtarbase database.
80
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (80)
miRTarBase ID miRNA Experiments Reference
MIRT051585 hsa-let-7e-5p CLASH 23622248
MIRT037511 hsa-miR-744-5p CLASH 23622248
MIRT571544 hsa-miR-541-5p PAR-CLIP 20371350
MIRT571543 hsa-miR-6500-3p PAR-CLIP 20371350
MIRT571542 hsa-miR-4509 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 18060868, 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606956 13049 ENSG00000152454
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2P7
Protein name Zinc finger protein 256 (Bone marrow zinc finger 3) (BMZF-3)
Protein function Transcriptional repressor that plays a role in cell proliferation. Requires TRIM28 for its activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 13 → 54 KRAB box Family
PF00096 zf-C2H2 239 → 261 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 267 → 289 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 295 → 317 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 323 → 345 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 351 → 373 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 379 → 401 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 407 → 429 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 435 → 457 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 463 → 485 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 491 → 513 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 519 → 541 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 547 → 569 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 575 → 597 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 603 → 625 Zinc finger, C2H2 type Domain
Sequence 
MAAAELTAPAQGIVTFEDVAVYFSWKEWGLLDEAQKCLYHDVMLENLTLTTSLGGSGAGD
EEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEICGPVLRQILHLVEHQGTHHGQKLYTD
GACRKQLQFTAYLHQHQKQHVGQKHFRSNGGRDMFLSSCTFEVSGKPFTCKEVGKDFLVR
SRFLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYM
CSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRIHTGVRPHQCDEC
GKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSF
IHSSSLITHQRVHTGTRPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRS
RFFQHQRVHTGVRSHECHECGKLFSRKFDLIVHERVHTGERPYECSECGKSFTCKSYLIS
HWKVHTGARPYECGECGKSFTHSSTLLQHQRVHTGERPYECNECGKFFSQSSSLIRHRRS
HTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGE
RPYECSDCGKFFTFNSNLLKHQNVHKG
Sequence length 627
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OBESITY — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Lymphoma Large B Cell Diffuse Associate 28731140
★★★★★
★☆☆☆☆
Found in Text Mining only