Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10161
Gene name Gene Name - the full gene name approved by the HGNC.	Lysophosphatidic acid receptor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LPAR6
Synonyms (NCBI Gene) Gene synonyms aliases	ARWH1, HYPT8, LAH3, LPA-6, P2RY5, P2Y5
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ARWH1, HYPT8
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the revers

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736565	hsa-miR-595	Western blotting, Microarray, qRT-PCR	22101077
MIRT1115496	hsa-miR-1252	CLIP-seq
MIRT1115497	hsa-miR-128	CLIP-seq
MIRT1115498	hsa-miR-27a	CLIP-seq
MIRT1115499	hsa-miR-27b	CLIP-seq
MIRT1115500	hsa-miR-5096	CLIP-seq
MIRT1115501	hsa-miR-513a-5p	CLIP-seq
MIRT1115497	hsa-miR-128	CLIP-seq
MIRT1115498	hsa-miR-27a	CLIP-seq
MIRT1115499	hsa-miR-27b	CLIP-seq
MIRT1115500	hsa-miR-5096	CLIP-seq
MIRT1115501	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001835	Process	Blastocyst hatching	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	18297070
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IBA	21873635
GO:0051482	Process	Positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	21873635
GO:0070915	Function	Lysophosphatidic acid receptor activity	IBA	21873635

MIM	HGNC	e!Ensembl
609239	15520	ENSG00000139679

Protein

UniProt ID

P43657

Protein name

Lysophosphatidic acid receptor 6 (LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5) (RB intron encoded G-protein coupled receptor)

Protein function

Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture.

PDB

9ITB , 9ITE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	34 → 291	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously, including in skin and hair follicle cells. Detected in both Henle's and Huxley's layers of the inner root sheath of the hair follicle and in suprabasal layers of the epidermis (at protein level). Expressed at lo

Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA

Sequence length

344

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Pathways in cancer		G alpha (q) signalling events P2Y receptors

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Hypotrichosis	Hypotrichosis, HYPOTRICHOSIS 8	rs121434306, rs121434307, rs121434308, rs121434309, rs1325804776, rs267606775, rs786200875, rs1568062215, rs267606776, rs1462595806, rs267606777, rs267606659, rs2147483647, rs559648418, rs121917819 View all (18 more)	18461368, 18297072, 25119526, 18297070
Hypotrichosis simplex	Hypotrichosis simplex	rs121913026, rs201249971	18461368, 18297070
Woolly hair, with or without hypotrichosis	WOOLLY HAIR, AUTOSOMAL RECESSIVE 1, WITH OR WITHOUT HYPOTRICHOSIS	rs559648418, rs267607219, rs1720449752, rs201868115, rs201249971

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	34769557
Breast Neoplasms	Associate	17047088, 37372960
Breast Neoplasms	Inhibit	34510318
Carcinogenesis	Associate	18475256
Carcinoma Hepatocellular	Associate	27583415, 29211777, 31236404
Carcinoma Squamous Cell	Associate	29211777
Crohn Disease	Associate	19253308
Hair Diseases	Associate	18803659
Hypotrichosis	Associate	18803659, 19365138, 22385360, 25119526
Hypotrichosis Localized Autosomal Recessive 1	Associate	32336749
Inflammation	Associate	19253308
Inflammatory Bowel Diseases	Associate	19253308
Lung Neoplasms	Associate	34769557
Microvascular Angina	Stimulate	27583415
Neoplasm Metastasis	Inhibit	34510318
Neoplasms	Associate	17702869, 29211777, 34769557, 37372960, 38354460
Neoplasms	Inhibit	18475256, 34510318
Neoplasms Adipose Tissue	Associate	38354460
Ovarian Neoplasms	Associate	17047088
Prostatic Neoplasms	Associate	29211777
Urethral Neoplasms	Associate	18475256
Urinary Bladder Neoplasms	Stimulate	18475256
Woolly Hair Autosomal Recessive	Associate	18803659, 22385360, 22592156
Woolly hair congenital	Associate	18803659, 19365138, 22385360

LPAR6 (lysophosphatidic acid receptor 6)