Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10159
Gene name Gene Name - the full gene name approved by the HGNC.
ATPase H+ transporting accessory protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATP6AP2
Synonyms (NCBI Gene) Gene synonyms aliases
(P)RR, APT6M8-9, ATP6IP2, ATP6M8-9, CDG2R, ELDF10, HT028, M8-9, MRXE, MRXSH, MSTP009, PRR, RENR, XMRE, XPDS
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH h
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918521 C>T Pathogenic Coding sequence variant, synonymous variant
rs397518480 C>T Pathogenic Synonymous variant, coding sequence variant
rs1057519331 T>A Pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019402 hsa-miR-148b-3p Microarray 17612493
MIRT029627 hsa-miR-26b-5p Microarray 19088304
MIRT036463 hsa-miR-1226-3p CLASH 23622248
MIRT660435 hsa-miR-4640-3p HITS-CLIP 23824327
MIRT660434 hsa-miR-6832-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane NAS 32001091
GO:0000220 Component Vacuolar proton-transporting V-type ATPase, V0 domain ISS
GO:0000421 Component Autophagosome membrane IEA
GO:0002003 Process Angiotensin maturation IDA 12045255, 15746149
GO:0005515 Function Protein binding IPI 12045255, 20093472, 29127204, 30374053, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300556 18305 ENSG00000182220
Protein
UniProt ID O75787
Protein name Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Va
Protein function Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and the acidification of the endo-lysosomal system (PubMed:12045255, Pub
PDB 3LBS , 3LC8 , 6WLW , 6WM2 , 6WM3 , 6WM4 , 7U4T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07850 Renin_r 254 350 Renin receptor-like protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in
Sequence
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSW
PGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEE
TPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVD
LLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYN
FEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Renin-angiotensin system   Metabolism of Angiotensinogen to Angiotensins
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Congenital disorder of glycosylation Congenital disorder of glycosylation, type IIr rs1926621737 N/A
Mental Retardation, X-Linked Syndromic X-linked intellectual disability Hedera type rs121918521, rs1926795050 N/A
Parkinsonism-Spasticity Syndrome, X-Linked x-linked parkinsonism-spasticity syndrome rs397518480 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33020972
Anophthalmia with pulmonary hypoplasia Associate 25747895
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 25503726
Breast Neoplasms Associate 24759179, 35401936, 37993606
Bronchiolitis Associate 19386802
Carcinogenesis Associate 23469216, 25747895
Carcinoma Pancreatic Ductal Associate 33820913
Carcinoma Renal Cell Associate 33916968
Cardio Renal Syndrome Associate 23469216
Cardiovascular Diseases Associate 23469216