Gene Gene information from NCBI Gene database.
Entrez ID 10159
Gene name ATPase H+ transporting accessory protein 2
Gene symbol ATP6AP2
Synonyms (NCBI Gene)
(P)RRAPT6M8-9ATP6IP2ATP6M8-9CDG2RELDF10HT028M8-9MRXEMRXSHMSTP009PRRRENRXMREXPDS
Chromosome X
Chromosome location Xp11.4
Summary This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH h
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs121918521 C>T Pathogenic Coding sequence variant, synonymous variant
rs397518480 C>T Pathogenic Synonymous variant, coding sequence variant
rs1057519331 T>A Pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
281
miRTarBase ID miRNA Experiments Reference
MIRT019402 hsa-miR-148b-3p Microarray 17612493
MIRT029627 hsa-miR-26b-5p Microarray 19088304
MIRT036463 hsa-miR-1226-3p CLASH 23622248
MIRT660435 hsa-miR-4640-3p HITS-CLIP 23824327
MIRT660434 hsa-miR-6832-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
59
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane NAS 32001091
GO:0000220 Component Vacuolar proton-transporting V-type ATPase, V0 domain ISS
GO:0000421 Component Autophagosome membrane IEA
GO:0002003 Process Angiotensin maturation IDA 12045255, 15746149
GO:0005515 Function Protein binding IPI 12045255, 20093472, 29127204, 30374053, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300556 18305 ENSG00000182220
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75787
Protein name Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Va
Protein function Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and the acidification of the endo-lysosomal system (PubMed:12045255, Pub
PDB 3LBS , 3LC8 , 6WLW , 6WM2 , 6WM3 , 6WM4 , 7U4T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07850 Renin_r 254 350 Renin receptor-like protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in
Sequence
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSW
PGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEE
TPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVD
LLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYN
FEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Renin-angiotensin system   Metabolism of Angiotensinogen to Angiotensins
Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
193
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital disorder of glycosylation, type IIr Pathogenic rs1926621737 RCV001078440
Syndromic X-linked intellectual disability Hedera type Likely pathogenic; Pathogenic rs2146543631, rs121918521, rs1926795050 RCV002272782
RCV000011548
RCV001078442
X-linked parkinsonism-spasticity syndrome Pathogenic rs397518480 RCV000074407
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ATP6AP2-related disorder Uncertain significance; Benign; Likely benign rs866274169, rs1450455949, rs190477001, rs759094089, rs2518966944, rs372993268 RCV006262007
RCV002471219
RCV004542933
RCV006261955
RCV004539056
RCV004538225
History of neurodevelopmental disorder Benign; Likely benign rs34217273, rs150392503 RCV000720952
RCV000721048
Nonpapillary renal cell carcinoma Benign; Likely benign rs138952430 RCV005903198
See cases Uncertain significance rs2146543649 RCV002252462
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33020972
Anophthalmia with pulmonary hypoplasia Associate 25747895
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 25503726
Breast Neoplasms Associate 24759179, 35401936, 37993606
Bronchiolitis Associate 19386802
Carcinogenesis Associate 23469216, 25747895
Carcinoma Pancreatic Ductal Associate 33820913
Carcinoma Renal Cell Associate 33916968
Cardio Renal Syndrome Associate 23469216
Cardiovascular Diseases Associate 23469216