Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10155
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 28
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM28
Synonyms (NCBI Gene) Gene synonyms aliases	KAP1, PPP1R157, RNF96, TF1B, TIF1B, TIF1beta
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.43
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromati

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052068	hsa-let-7b-5p	CLASH	23622248
MIRT051347	hsa-miR-15a-5p	CLASH	23622248
MIRT049953	hsa-miR-30a-5p	CLASH	23622248
MIRT049122	hsa-miR-92a-3p	CLASH	23622248
MIRT047101	hsa-miR-183-5p	CLASH	23622248
MIRT046915	hsa-miR-221-3p	CLASH	23622248
MIRT045571	hsa-miR-149-5p	CLASH	23622248
MIRT041711	hsa-miR-484	CLASH	23622248
MIRT041271	hsa-miR-193b-3p	CLASH	23622248
MIRT041001	hsa-miR-505-3p	CLASH	23622248
MIRT038878	hsa-miR-93-3p	CLASH	23622248
MIRT038141	hsa-miR-423-5p	CLASH	23622248
MIRT037943	hsa-miR-505-5p	CLASH	23622248
MIRT037599	hsa-miR-744-5p	CLASH	23622248
MIRT037068	hsa-miR-877-3p	CLASH	23622248
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	23592263
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT465279	hsa-miR-4481	PAR-CLIP	23592263
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT465277	hsa-miR-4450	PAR-CLIP	23592263
MIRT465276	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT465274	hsa-miR-4651	PAR-CLIP	23592263
MIRT465273	hsa-miR-608	PAR-CLIP	23592263
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT465271	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT465270	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	23592263
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT465279	hsa-miR-4481	PAR-CLIP	23592263
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT465277	hsa-miR-4450	PAR-CLIP	23592263
MIRT465276	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT465274	hsa-miR-4651	PAR-CLIP	23592263
MIRT465273	hsa-miR-608	PAR-CLIP	23592263
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT465271	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT465270	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT1453734	hsa-miR-1275	CLIP-seq
MIRT1453735	hsa-miR-3187-3p	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453737	hsa-miR-3915	CLIP-seq
MIRT1453738	hsa-miR-3928	CLIP-seq
MIRT1453739	hsa-miR-4488	CLIP-seq
MIRT1453740	hsa-miR-4525	CLIP-seq
MIRT1453741	hsa-miR-4529-5p	CLIP-seq
MIRT1453742	hsa-miR-4665-5p	CLIP-seq
MIRT1453743	hsa-miR-4697-5p	CLIP-seq
MIRT1453744	hsa-miR-4723-5p	CLIP-seq
MIRT1453745	hsa-miR-548aa	CLIP-seq
MIRT1453746	hsa-miR-548ac	CLIP-seq
MIRT1453747	hsa-miR-548ae	CLIP-seq
MIRT1453748	hsa-miR-548aj	CLIP-seq
MIRT1453749	hsa-miR-548am	CLIP-seq
MIRT1453750	hsa-miR-548d-3p	CLIP-seq
MIRT1453751	hsa-miR-548x	CLIP-seq
MIRT1453752	hsa-miR-548z	CLIP-seq
MIRT1453753	hsa-miR-605	CLIP-seq
MIRT1453754	hsa-miR-625	CLIP-seq
MIRT1453755	hsa-miR-637	CLIP-seq
MIRT1453735	hsa-miR-3187-3p	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453741	hsa-miR-4529-5p	CLIP-seq
MIRT1453734	hsa-miR-1275	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453740	hsa-miR-4525	CLIP-seq
MIRT1453742	hsa-miR-4665-5p	CLIP-seq
MIRT1453744	hsa-miR-4723-5p	CLIP-seq
MIRT1453754	hsa-miR-625	CLIP-seq
MIRT1453755	hsa-miR-637	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ZNF350	Unknown	22975076

Show/Hide all(77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003677	Function	DNA binding	IDA	9016654
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	27029610
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003714	Function	Transcription corepressor activity	IDA	8769649
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18082607
GO:0005515	Function	Protein binding	IPI	9016654, 10330177, 11013263, 16169070, 17512541, 17704056, 18060868, 18675275, 18854139, 19498464, 20424263, 20562864, 20858735, 20864041, 20936779, 21170338, 21277283, 21549307, 21642969, 21888893, 22975076, 22995936, 23034801, 23543754, 23665872, 24018422, 24657165, 24981860, 2649
GO:0005634	Component	Nucleus	IDA	8769649, 9016654, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IDA	17178852
GO:0006325	Process	Chromatin organization	IBA
GO:0006325	Process	Chromatin organization	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IMP	24623306
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	ISS
GO:0007566	Process	Embryo implantation	IEA
GO:0008270	Function	Zinc ion binding	IDA	10653693, 11226167
GO:0008270	Function	Zinc ion binding	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	18082607
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	17298944
GO:0019789	Function	SUMO transferase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	18082607
GO:0032991	Component	Protein-containing complex	IDA	17512541
GO:0032991	Component	Protein-containing complex	IEA
GO:0035851	Function	Krueppel-associated box domain binding	IDA	17512541, 23665872
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	23665872
GO:0043045	Process	Epigenetic programming of gene expression	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045739	Process	Positive regulation of DNA repair	IDA	17178852
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9016654
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060669	Process	Embryonic placenta morphogenesis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	36354136
GO:0061659	Function	Ubiquitin-like protein ligase activity	IEA
GO:0070087	Function	Chromo shadow domain binding	IPI	15882967
GO:0071514	Process	Genomic imprinting	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:1990841	Function	Promoter-specific chromatin binding	IDA	24623306

MIM	HGNC	e!Ensembl
601742	16384	ENSG00000130726

Protein

UniProt ID

Q13263

Protein name

Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin trans

Protein function

Nuclear corepressor for KRAB domain-containing zinc finger proteins (KRAB-ZFPs). Mediates gene silencing by recruiting CHD3, a subunit of the nucleosome remodeling and deacetylation (NuRD) complex, and SETDB1 (which specifically methylates histo

PDB

1FP0 , 2RO1 , 2YVR , 6H3A , 6I9H , 6QAJ , 6QU1 , 7Z36

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14634	zf-RING_5	64 → 122	zinc-RING finger domain	Domain
PF00643	zf-B_box	148 → 195	B-box zinc finger	Domain
PF00643	zf-B_box	204 → 245	B-box zinc finger	Domain
PF00628	PHD	627 → 672	PHD-finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested including spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:9016654}.

Sequence

MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVC
KQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEA
HQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDH
QYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAIL
QIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTA
LLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSG
LMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAG
TPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTS
SGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVP
GEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPL
HQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKA
DVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP

Sequence length

835

Interactions

View interactions

	Reactome
			Generic Transcription Pathway SUMOylation of transcription cofactors HCMV Early Events

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
colorectal cancer	Familial colorectal cancer	N/A	N/A	ClinVar
Wilms tumor	kidney Wilms tumor, childhood kidney Wilms tumor	N/A	N/A	GenCC

Show/Hide Text Mining Associations (56)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	24983967
Adenocarcinoma of Lung	Associate	29127420, 33091876, 33221751
Atherosclerosis	Associate	32725144
Autism Spectrum Disorder	Associate	35682642
Breast Neoplasms	Associate	27412325, 28068325, 31253870, 35031618
Burkitt Lymphoma	Associate	28249048
Carcinogenesis	Associate	38058023
Carcinoma Hepatocellular	Associate	30309319, 33589597, 35142083, 36238495, 36354136, 37870748, 40234915
Carcinoma Merkel Cell	Associate	32156811
Carcinoma Non Small Cell Lung	Associate	37748077
Carcinoma Ovarian Epithelial	Stimulate	25548895
Carcinoma Squamous Cell	Associate	30484263
Colorectal Neoplasms	Associate	28864417, 29631612
COVID 19	Associate	34299101, 35579274, 36192760, 38172120
Diabetes Mellitus	Associate	31919284
Drug Related Side Effects and Adverse Reactions	Associate	36062323
Embryo Loss	Associate	37372979
Encephalitis	Associate	35682642
Esophageal Squamous Cell Carcinoma	Associate	30484263
Glioblastoma	Associate	27905892, 28498803
Glioma	Associate	27905892
Glomerulonephritis IGA	Associate	34823491
Glycosuria Renal	Associate	30543698
Hypoxia	Inhibit	24278015
Hypoxia	Associate	24696491, 33398366, 35031618
Hypoxia Brain	Associate	32176739
Influenza Human	Associate	35458419
Interferon gamma receptor 1 deficiency	Associate	34299101
Intervertebral Disc Degeneration	Associate	37438603
Leukemia Lymphocytic Chronic B Cell	Associate	35533307
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34253692, 35743282
Lung Neoplasms	Associate	24983967, 28592245, 37748077
Lymphatic Metastasis	Stimulate	30484263
Malformations of Cortical Development Group I	Stimulate	33398366
Melanoma	Associate	30042493, 30309319, 36341538
Multiple Sclerosis	Associate	36992419
Neoplasm Metastasis	Associate	23991171, 24983967, 25548895, 27412325
Neoplasm Metastasis	Stimulate	30484263
Neoplasms	Associate	20864041, 25548895, 25945414, 28592290, 28864417, 29631612, 30309319, 30479348, 30543698, 30885698, 32402252, 32796077, 33091876, 34440702, 35549637 View all (8 more)
Neoplasms	Inhibit	22231120, 24983967, 38058023
Neuroinflammatory Diseases	Associate	36992419
Ovarian Diseases	Associate	25510701
Ovarian Neoplasms	Associate	25548895
Plaque Atherosclerotic	Associate	32725144
Prostatic Neoplasms	Associate	27780869, 28592290, 30479348
Prostatitis	Associate	37070200
Purpura Thrombocytopenic Idiopathic	Associate	37628621
Sarcoma Kaposi	Associate	23740979, 24696491
Stomach Neoplasms	Associate	37443302, 38058023
Thyroid Neoplasms	Stimulate	35549637
Urinary Bladder Neoplasms	Associate	34518220
Uterine Cervical Dysplasia	Stimulate	30484263
Uterine Cervical Neoplasms	Associate	23991171
Vascular Diseases	Associate	32725144
Virus Diseases	Associate	35458419
Wilms Tumor	Associate	29912901, 30543698, 32699065, 37792584, 38110397, 40340749

TRIM28 (tripartite motif containing 28)