Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1015
Gene name Gene Name - the full gene name approved by the HGNC.	Cadherin 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDH17
Synonyms (NCBI Gene) Gene synonyms aliases	CDH16, HPT-1, HPT1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region

Show/Hide all(126)

miRTarBase ID	miRNA	Experiments
MIRT879716	hsa-miR-1206	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT879718	hsa-miR-1276	CLIP-seq
MIRT879719	hsa-miR-140-5p	CLIP-seq
MIRT879720	hsa-miR-141	CLIP-seq
MIRT879721	hsa-miR-200a	CLIP-seq
MIRT879722	hsa-miR-200b	CLIP-seq
MIRT879723	hsa-miR-200c	CLIP-seq
MIRT879724	hsa-miR-2053	CLIP-seq
MIRT879725	hsa-miR-2682	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT879727	hsa-miR-3157-5p	CLIP-seq
MIRT879728	hsa-miR-3160-3p	CLIP-seq
MIRT879729	hsa-miR-3168	CLIP-seq
MIRT879730	hsa-miR-3614-5p	CLIP-seq
MIRT879731	hsa-miR-374c	CLIP-seq
MIRT879732	hsa-miR-3926	CLIP-seq
MIRT879733	hsa-miR-4277	CLIP-seq
MIRT879734	hsa-miR-429	CLIP-seq
MIRT879735	hsa-miR-4433	CLIP-seq
MIRT879736	hsa-miR-4459	CLIP-seq
MIRT879737	hsa-miR-4475	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879739	hsa-miR-4487	CLIP-seq
MIRT879740	hsa-miR-449c	CLIP-seq
MIRT879741	hsa-miR-450b-3p	CLIP-seq
MIRT879742	hsa-miR-4514	CLIP-seq
MIRT879743	hsa-miR-4645-5p	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879745	hsa-miR-4668-5p	CLIP-seq
MIRT879746	hsa-miR-4673	CLIP-seq
MIRT879747	hsa-miR-4691-3p	CLIP-seq
MIRT879748	hsa-miR-4692	CLIP-seq
MIRT879749	hsa-miR-4694-3p	CLIP-seq
MIRT879750	hsa-miR-4695-5p	CLIP-seq
MIRT879751	hsa-miR-4712-3p	CLIP-seq
MIRT879752	hsa-miR-4713-3p	CLIP-seq
MIRT879753	hsa-miR-4742-3p	CLIP-seq
MIRT879754	hsa-miR-4768-3p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT879756	hsa-miR-522	CLIP-seq
MIRT879757	hsa-miR-548s	CLIP-seq
MIRT879758	hsa-miR-558	CLIP-seq
MIRT879759	hsa-miR-569	CLIP-seq
MIRT879760	hsa-miR-638	CLIP-seq
MIRT879761	hsa-miR-655	CLIP-seq
MIRT879762	hsa-miR-658	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879764	hsa-miR-665	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879766	hsa-miR-769-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT879728	hsa-miR-3160-3p	CLIP-seq
MIRT879732	hsa-miR-3926	CLIP-seq
MIRT879735	hsa-miR-4433	CLIP-seq
MIRT879736	hsa-miR-4459	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879739	hsa-miR-4487	CLIP-seq
MIRT879741	hsa-miR-450b-3p	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879750	hsa-miR-4695-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879752	hsa-miR-4713-3p	CLIP-seq
MIRT879754	hsa-miR-4768-3p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT879757	hsa-miR-548s	CLIP-seq
MIRT879758	hsa-miR-558	CLIP-seq
MIRT879760	hsa-miR-638	CLIP-seq
MIRT879762	hsa-miR-658	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879764	hsa-miR-665	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879766	hsa-miR-769-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT2500637	hsa-miR-323-5p	CLIP-seq
MIRT2500638	hsa-miR-3622b-5p	CLIP-seq
MIRT2500639	hsa-miR-3945	CLIP-seq
MIRT2500640	hsa-miR-4253	CLIP-seq
MIRT2500641	hsa-miR-4432	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2500642	hsa-miR-541	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT2500643	hsa-miR-654-5p	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT2500644	hsa-miR-876-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT2500637	hsa-miR-323-5p	CLIP-seq
MIRT2500638	hsa-miR-3622b-5p	CLIP-seq
MIRT2500639	hsa-miR-3945	CLIP-seq
MIRT2500640	hsa-miR-4253	CLIP-seq
MIRT2500641	hsa-miR-4432	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT2500644	hsa-miR-876-3p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CDX2	Activation	20568120
CDX2	Unknown	12404231;15732140
HNF1A	Activation	20568120

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002314	Process	Germinal center B cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0005178	Function	Integrin binding	IPI	25336636
GO:0005215	Function	Transporter activity	TAS	8153632
GO:0005427	Function	Proton-dependent oligopeptide secondary active transmembrane transporter activity	ISS
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006857	Process	Oligopeptide transport	ISS
GO:0007155	Process	Cell adhesion	TAS	8153632
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA	21873635
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	25336636
GO:0009986	Component	Cell surface	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15279905
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0016342	Component	Catenin complex	IBA	21873635
GO:0030054	Component	Cell junction	IDA
GO:0033626	Process	Positive regulation of integrin activation by cell surface receptor linked signal transduction	IMP	25336636
GO:0034332	Process	Adherens junction organization	TAS
GO:0035672	Process	Oligopeptide transmembrane transport	ISS
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0048536	Process	Spleen development	IEA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA	21873635

MIM	HGNC	e!Ensembl
603017	1756	ENSG00000079112

Protein

UniProt ID

Q12864

Protein name

Cadherin-17 (Intestinal peptide-associated transporter HPT-1) (Liver-intestine cadherin) (LI-cadherin)

Protein function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a rol

PDB

6ULM , 7CYM , 7EV1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	131 → 235	Cadherin domain	Domain
PF00028	Cadherin	243 → 331	Cadherin domain	Domain
PF00028	Cadherin	345 → 440	Cadherin domain	Domain
PF00028	Cadherin	456 → 558	Cadherin domain	Domain
PF00028	Cadherin	571 → 657	Cadherin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin. {ECO:0000269|PubMed:8153632}.

Sequence

MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS

Sequence length

832

Interactions

View interactions

	KEGG		Reactome
	Gastric cancer		Adherens junctions interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Esophagus neoplasm	Esophageal Neoplasms	rs28934578, rs121918714, rs1567556006, rs1575166666	22960999

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Asthma, Occupational	25918132	ClinVar
Major affective disorder	MAJOR AFFECTIVE DISORDER 2	17938632	ClinVar
Coronary artery disease	Coronary artery disease		GWAS
Oligodendroglioma	Oligodendroglioma		GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	11413113, 23053896, 28029907, 34818353, 38452580
Adenocarcinoma of Lung	Associate	35242247, 38608841, 40179422
Adenoma	Associate	25768256
Asthma	Associate	25918132
Barrett Esophagus	Associate	29257318
Carbon Monoxide Poisoning	Associate	35140817
Carcinogenesis	Associate	23053896
Carcinoma Hepatocellular	Associate	19626651
Carcinoma Medullary	Associate	24437456
Carcinoma Ovarian Epithelial	Associate	22810971
Carcinoma Signet Ring Cell	Associate	17589897
Carcinoma Squamous Cell	Associate	40179422
Colonic Neoplasms	Associate	18552820, 24437456, 28029907, 38452580
Colorectal Neoplasms	Associate	23326130, 24437456, 28029907, 30227326, 37081068, 38608841
Digestive System Neoplasms	Associate	18552820
Hypereosinophilic Syndrome	Associate	26497854
Intestinal Diseases	Associate	11413113, 20398667, 23053896, 28453457
Intestinal Neoplasms	Associate	24437456
Lymphatic Metastasis	Associate	23326130, 37081068
Metaplasia	Associate	11413113, 20398667
Neoplasm Metastasis	Associate	17406026, 22810971, 26743780, 27580354, 28029907, 30227326, 37081068
Neoplasm Metastasis	Stimulate	23089909
Neoplasm Metastasis	Inhibit	38452580
Neoplasms	Associate	11413113, 19626651, 22810971, 23053896, 23089909, 26743780, 28029907, 38452580
Neoplasms	Inhibit	26497854
Neoplasms Glandular and Epithelial	Associate	38452580
Ovarian Neoplasms	Associate	38452580
Pancreatic Neoplasms	Associate	25307987
Pancreatic Neoplasms	Inhibit	38452580
Pancreatitis	Associate	18552820
Stomach Neoplasms	Associate	18552820, 20398667, 22048633, 22676223, 23053896, 23089909, 26743780, 27580354, 28029907, 28387908, 28453457, 34364873
Urologic Diseases	Associate	25768256

CDH17 (cadherin 17)