EBI3 (Epstein-Barr virus induced 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10148
Gene name Gene Name - the full gene name approved by the HGNC.
Epstein-Barr virus induced 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EBI3
Synonyms (NCBI Gene) Gene synonyms aliases
IL-27B, IL27B, IL35B
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(56)
miRTarBase ID miRNA Experiments Reference
MIRT042869 hsa-miR-324-3p CLASH 23622248
MIRT496548 hsa-miR-508-5p PAR-CLIP 22291592
MIRT496547 hsa-miR-1910-3p PAR-CLIP 22291592
MIRT496546 hsa-miR-6511a-5p PAR-CLIP 22291592
MIRT496545 hsa-miR-6808-5p PAR-CLIP 22291592
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
NFKB1 Activation 9733827
NFKBIA Repression 9733827
RELA Activation 9733827
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004896 Function Cytokine receptor activity IPI 9342359
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 9342359, 20974977
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605816 3129 ENSG00000105246
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q14213
Protein name Interleukin-27 subunit beta (IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein) (EBV-induced gene 3 protein)
Protein function Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula
PDB 7U7N , 7ZXK , 8D85 , 8XWY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 130 → 215 Fibronectin type III domain Domain
Sequence 
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Sequence length 229
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Th17 cell differentiation 		  Interleukin-35 Signalling
Interleukin-27 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 16367923
Show/Hide Text Mining Associations (48)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 15793300
Arthritis Psoriatic Associate 34884474
Arthritis Rheumatoid Associate 36548354
Atherosclerosis Associate 19556516
Behcet Syndrome Associate 34950136
Burkitt Lymphoma Associate 21931777
Carcinoma Hepatocellular Associate 26109807
Carcinoma Pancreatic Ductal Associate 33761652
Cognition Disorders Associate 32756130
Colitis Associate 34069352