Gene Gene information from NCBI Gene database.
Entrez ID 10148
Gene name Epstein-Barr virus induced 3
Gene symbol EBI3
Synonyms (NCBI Gene)
IL-27BIL27BIL35B
Chromosome 19
Chromosome location 19p13.3
Summary This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin
miRNA miRNA information provided by mirtarbase database.
56
miRTarBase ID miRNA Experiments Reference
MIRT042869 hsa-miR-324-3p CLASH 23622248
MIRT496548 hsa-miR-508-5p PAR-CLIP 22291592
MIRT496547 hsa-miR-1910-3p PAR-CLIP 22291592
MIRT496546 hsa-miR-6511a-5p PAR-CLIP 22291592
MIRT496545 hsa-miR-6808-5p PAR-CLIP 22291592
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Activation 9733827
NFKBIA Repression 9733827
RELA Activation 9733827
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004896 Function Cytokine receptor activity IEA
GO:0004896 Function Cytokine receptor activity IPI 9342359
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 9342359, 20974977
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605816 3129 ENSG00000105246
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14213
Protein name Interleukin-27 subunit beta (IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein) (EBV-induced gene 3 protein)
Protein function Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula
PDB 7U7N , 7ZXK , 8D85 , 8XWY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 130 215 Fibronectin type III domain Domain
Sequence
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELS
DWSLPATATMSLGK
Sequence length 229
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Th17 cell differentiation
  Interleukin-35 Signalling
Interleukin-27 signaling