Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10148
Gene name Gene Name - the full gene name approved by the HGNC.	Epstein-Barr virus induced 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EBI3
Synonyms (NCBI Gene) Gene synonyms aliases	IL-27B, IL27B, IL35B
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042869	hsa-miR-324-3p	CLASH	23622248
MIRT496548	hsa-miR-508-5p	PAR-CLIP	22291592
MIRT496547	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496546	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496545	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496544	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496543	hsa-miR-940	PAR-CLIP	22291592
MIRT496542	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496541	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496540	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496539	hsa-miR-4690-3p	PAR-CLIP	22291592
MIRT496538	hsa-miR-5685	PAR-CLIP	22291592
MIRT496537	hsa-miR-6849-3p	PAR-CLIP	22291592
MIRT496536	hsa-miR-766-3p	PAR-CLIP	22291592
MIRT496535	hsa-miR-6069	PAR-CLIP	22291592
MIRT496534	hsa-miR-6512-3p	PAR-CLIP	22291592
MIRT496533	hsa-miR-6720-5p	PAR-CLIP	22291592
MIRT496548	hsa-miR-508-5p	PAR-CLIP	22291592
MIRT496547	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496546	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496545	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496544	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496543	hsa-miR-940	PAR-CLIP	22291592
MIRT496542	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496541	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496540	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496539	hsa-miR-4690-3p	PAR-CLIP	22291592
MIRT496538	hsa-miR-5685	PAR-CLIP	22291592
MIRT496537	hsa-miR-6849-3p	PAR-CLIP	22291592
MIRT496536	hsa-miR-766-3p	PAR-CLIP	22291592
MIRT496535	hsa-miR-6069	PAR-CLIP	22291592
MIRT496534	hsa-miR-6512-3p	PAR-CLIP	22291592
MIRT496533	hsa-miR-6720-5p	PAR-CLIP	22291592
MIRT951411	hsa-miR-15a	CLIP-seq
MIRT951412	hsa-miR-15b	CLIP-seq
MIRT951413	hsa-miR-16	CLIP-seq
MIRT951414	hsa-miR-195	CLIP-seq
MIRT951415	hsa-miR-214	CLIP-seq
MIRT951416	hsa-miR-330-3p	CLIP-seq
MIRT951417	hsa-miR-3619-5p	CLIP-seq
MIRT951418	hsa-miR-424	CLIP-seq
MIRT951419	hsa-miR-4291	CLIP-seq
MIRT951420	hsa-miR-4660	CLIP-seq
MIRT951421	hsa-miR-497	CLIP-seq
MIRT951422	hsa-miR-545	CLIP-seq
MIRT951423	hsa-miR-761	CLIP-seq
MIRT951424	hsa-miR-922	CLIP-seq
MIRT1981821	hsa-miR-2467-5p	CLIP-seq
MIRT1981822	hsa-miR-3123	CLIP-seq
MIRT1981823	hsa-miR-3188	CLIP-seq
MIRT1981824	hsa-miR-3925-5p	CLIP-seq
MIRT1981825	hsa-miR-3975	CLIP-seq
MIRT1981826	hsa-miR-4649-3p	CLIP-seq
MIRT1981827	hsa-miR-4738-3p	CLIP-seq
MIRT1981828	hsa-miR-485-5p	CLIP-seq
MIRT1981826	hsa-miR-4649-3p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFKB1	Activation	9733827
NFKBIA	Repression	9733827
RELA	Activation	9733827

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004896	Function	Cytokine receptor activity	IPI	9342359
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	9342359, 20974977
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	8551575
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	TAS	8551575
GO:0006959	Process	Humoral immune response	TAS	8551575
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0032729	Process	Positive regulation of type II interferon production	TAS	14743498
GO:0042088	Process	T-helper 1 type immune response	TAS	14743498
GO:0042098	Process	T cell proliferation	IBA
GO:0042098	Process	T cell proliferation	IEA
GO:0045523	Function	Interleukin-27 receptor binding	IBA
GO:0045523	Function	Interleukin-27 receptor binding	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	TAS	14743498

MIM	HGNC	e!Ensembl
605816	3129	ENSG00000105246

Protein

UniProt ID

Q14213

Protein name

Interleukin-27 subunit beta (IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein) (EBV-induced gene 3 protein)

Protein function

Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula

PDB

7U7N , 7ZXK , 8D85 , 8XWY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	130 → 215	Fibronectin type III domain	Domain

Sequence

MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Sequence length

229

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Th17 cell differentiation		Interleukin-35 Signalling Interleukin-27 signaling

EBI3 (Epstein-Barr virus induced 3)