CLEC3A (C-type lectin domain family 3 member A)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10143
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 3 member A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC3A
Synonyms (NCBI Gene) Gene synonyms aliases
CLECSF1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT896018 hsa-miR-1179 CLIP-seq
MIRT896019 hsa-miR-216a CLIP-seq
MIRT896020 hsa-miR-219-1-3p CLIP-seq
MIRT896021 hsa-miR-33a CLIP-seq
MIRT896022 hsa-miR-33b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development TAS 10524194
GO:0001503 Process Ossification IBA 21873635
GO:0005615 Component Extracellular space IBA 21873635
GO:0030246 Function Carbohydrate binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613588 2052 ENSG00000166509
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O75596
Protein name C-type lectin domain family 3 member A (C-type lectin superfamily member 1) (Cartilage-derived C-type lectin)
Protein function Promotes cell adhesion to laminin-332 and fibronectin.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 84 → 193 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Restricted to cartilage and breast. Also expressed in breast cancers. {ECO:0000269|PubMed:19173304}.
Sequence 
MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKE
IQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKR
SLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
EACRSSKRYICEFTIPQ
Sequence length 197
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 26621817
Colorectal cancer Colorectal Carcinoma, Adenocarcinoma of large intestine rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)		 26621817
Colorectal neoplasms Colorectal Neoplasms, Malignant neoplasm of large intestine rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)		 26621817
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Takayasu Arteritis Takayasu Arteritis GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 31983196, 35120331
Intervertebral Disc Degeneration Associate 35409356
Lymphatic Metastasis Stimulate 32319617
Neoplasms Associate 31129920
Neuroendocrine Tumors Associate 31129920
Osteoarthritis Associate 20060954
Osteosarcoma Inhibit 32319617
Tertiary Lymphoid Structures Inhibit 31983196
Triple Negative Breast Neoplasms Stimulate 37391754