Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10133
Gene name Gene Name - the full gene name approved by the HGNC.
Optineurin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OPTN
Synonyms (NCBI Gene) Gene synonyms aliases
ALS12, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs11258194 T>A Pathogenic, benign-likely-benign, risk-factor, benign Missense variant, coding sequence variant
rs28939688 G>A Pathogenic Missense variant, coding sequence variant
rs75654767 G>A Pathogenic, benign, likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs140599944 G>A,T Uncertain-significance, likely-pathogenic Stop gained, missense variant, coding sequence variant
rs142812715 A>T Pathogenic, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019128 hsa-miR-335-5p Microarray 18185580
MIRT021455 hsa-miR-9-5p Microarray 17612493
MIRT050845 hsa-miR-17-5p CLASH 23622248
MIRT050771 hsa-miR-17-3p CLASH 23622248
MIRT049818 hsa-miR-92a-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 19340308
RELA Activation 19340308
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0001920 Process Negative regulation of receptor recycling IMP 22854040
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 15837803, 16189514, 17500595, 17646400, 18307994, 19805065, 20174559, 20195357, 20388642, 21516116, 21617041, 21903422, 21988832, 22854040, 23275563, 23414517, 23956131, 24136289, 24705354, 25026213, 25416956, 25803835, 25910212, 26871637, 27086836, 29892012, 30561431, 31515488, 322
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602432 17142 ENSG00000123240
Protein
UniProt ID Q96CV9
Protein name Optineurin (E3-14.7K-interacting protein) (FIP-2) (Huntingtin yeast partner L) (Huntingtin-interacting protein 7) (HIP-7) (Huntingtin-interacting protein L) (NEMO-related protein) (Optic neuropathy-inducing protein) (Transcription factor IIIA-interacting
Protein function Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8 (PubMed:27534431). Links myosin VI to the Golgi complex and plays an important role in Golgi
PDB 2LO4 , 2LUE , 3VTV , 3VTW , 5AAZ , 5B83 , 5EOA , 5EOF , 7CZM , 9B0B , 9B0Z , 9B12 , 9IKQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11577 NEMO 37 104 NF-kappa-B essential modulator NEMO Family
PF16516 CC2-LZ 408 507 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
PF18414 zf_C2H2_10 551 576 Domain
Tissue specificity TISSUE SPECIFICITY: Present in aqueous humor of the eye (at protein level). Expressed in the trabecular meshwork (at protein level) (PubMed:11834836, PubMed:12379221, PubMed:12646749). Expressed in nonpigmented ciliary epithelium (at protein level) (PubMe
Sequence
MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKL
NNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHEN
EKLKEELGKLKGKSER
SSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVE
IRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCL
REGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVE
ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKK
LELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERA
AREKIHEEKEQLALQLAVLLKENDAFE
DGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAE
DRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII
Sequence length 577
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mitophagy - animal
Autophagy - animal
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
  Regulation of PLK1 Activity at G2/M Transition
TBC/RABGAPs
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis type 12 rs267606929, rs786205611, rs140599944, rs1833371664, rs1833438306, rs1833451208, rs267606928 N/A
Motor Neuron Disease motor neuron disease rs895824243 N/A
Open Angle Glaucoma glaucoma 1, open angle, e rs774258585, rs28939688 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glaucoma glaucoma, normal tension, susceptibility to N/A N/A GenCC
Sarcoidosis Sarcoidosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21360076, 35666053
Amyotrophic Lateral Sclerosis Associate 21408173, 21550138, 23078282, 23100398, 23755159, 23881933, 25294927, 25681989, 25700176, 25801386, 25803835, 25943890, 26303227, 26365381, 26740678
View all (13 more)
Amyotrophic lateral sclerosis 1 Associate 21360076, 31838784
Blindness Associate 17663725, 18485006, 20085643
Bone Diseases Associate 28993189
Breast Neoplasms Associate 33917174
Carcinoma Hepatocellular Associate 37043475
Cognition Disorders Associate 34528736
Cognitive Dysfunction Associate 34528736
Colorectal Neoplasms Associate 36333388