Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10131
Gene name	TNF receptor associated protein 1
Gene symbol	TRAP1
Synonyms (NCBI Gene)	HSP 75HSP75HSP90LTRAP-1
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stres

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113476582	T>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031812	hsa-miR-16-5p	Proteomics	18668040
MIRT049372	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT031812	hsa-miR-16-5p	CLASH	23622248
MIRT050940	hsa-miR-17-5p	CLASH	23622248
MIRT050345	hsa-miR-25-3p	CLASH	23622248
MIRT050189	hsa-miR-26a-5p	CLASH	23622248
MIRT049372	hsa-miR-92a-3p	CLASH	23622248
MIRT048268	hsa-miR-196a-5p	CLASH	23622248
MIRT048118	hsa-miR-197-3p	CLASH	23622248
MIRT046825	hsa-miR-222-3p	CLASH	23622248
MIRT045658	hsa-miR-149-5p	CLASH	23622248
MIRT045192	hsa-miR-186-5p	CLASH	23622248
MIRT043734	hsa-miR-342-3p	CLASH	23622248
MIRT043532	hsa-miR-331-3p	CLASH	23622248
MIRT043185	hsa-miR-324-5p	CLASH	23622248
MIRT042452	hsa-miR-424-5p	CLASH	23622248
MIRT041401	hsa-miR-193b-3p	CLASH	23622248
MIRT040106	hsa-miR-615-3p	CLASH	23622248
MIRT039132	hsa-miR-769-3p	CLASH	23622248
MIRT038265	hsa-miR-361-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT2356356	hsa-miR-320a	CLIP-seq
MIRT2356357	hsa-miR-320b	CLIP-seq
MIRT2356358	hsa-miR-320c	CLIP-seq
MIRT2356359	hsa-miR-320d	CLIP-seq
MIRT2356360	hsa-miR-331-5p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT2356361	hsa-miR-4429	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005164	Function	Tumor necrosis factor receptor binding	NAS	7876093
GO:0005515	Function	Protein binding	IPI	17579517, 23564345, 23747254, 29128334
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17579517
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	23564345
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005758	Component	Mitochondrial intermembrane space	ISS	17579517
GO:0005759	Component	Mitochondrial matrix	IDA	23564345
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	TAS	24522549
GO:0009386	Process	Translational attenuation	IMP	24113185
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	17579517
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0070013	Component	Intracellular organelle lumen	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1901856	Process	Negative regulation of cellular respiration	IMP	23564345
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	TAS	18221368
GO:1903751	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	ISS	17579517

MIM	HGNC	e!Ensembl
606219	16264	ENSG00000126602

Q12931

Protein name

Heat shock protein 75 kDa, mitochondrial (HSP 75) (Heat shock protein family C member 5) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1)

Protein function

Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance betw

PDB

4Z1F , 4Z1G , 4Z1H , 4Z1I , 5F3K , 5F5R , 5HPH , 5Y3N , 5Y3O , 6XG6 , 7C04 , 7C05 , 7C7B , 7C7C , 7KCK , 7KCL , 7KCM , 7KLU , 7KLV , 7U8U , 7U8V , 7U8W , 7U8X , 7ULK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02518	HATPase_c	108 → 260	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
PF00183	HSP90	288 → 704	Hsp90 protein	Family

Tissue specificity

TISSUE SPECIFICITY: Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung, placenta and bladder. Expression is highly reduced in bladder cancer and renal cell carcinoma specimens compared to healthy tissues, but it is increased in other ty

Sequence

MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH

Sequence length

704

Interactions

View interactions

	KEGG
	Parkinson disease Pathways of neurodegeneration - multiple diseases

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital anomalies of kidney and urinary tract 1	Pathogenic	rs2548299083	RCV003235001

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs61753379	RCV005901543
Cholangiocarcinoma	Benign	rs61753379	RCV005901549
Familial cancer of breast	Uncertain significance; Conflicting classifications of pathogenicity	rs763294359, rs373016534	RCV005930366 RCV005929409
Gastric cancer	Uncertain significance	rs750282364	RCV005939284
Hepatocellular carcinoma	Benign	rs61753379	RCV005901544
HER2 positive breast carcinoma	Conflicting classifications of pathogenicity	rs61756352	RCV002466514
Hereditary renal cell carcinoma	Benign	rs77440336	RCV000678680
Lung cancer	Benign	rs373961891	RCV005932028
Sarcoma	Benign	rs61753379	RCV005901546
Thymoma	Benign	rs61753379	RCV005901548
TRAP1-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	rs769027196, rs147617137, rs369893908, rs115100713, rs116729116, rs376506055, rs368889500, rs776393611, rs775141873, rs774864487, rs769430278, rs774842639, rs995881750, rs759452840, rs745722743 View all (14 more)	RCV003892986 RCV003978884 RCV003916282 RCV003951107 RCV003916619 RCV003973576 RCV004747174 RCV003963544 RCV003434655 RCV003420529 RCV003411975 RCV003392936 RCV003394329 RCV003981776 RCV003894166 RCV003902183 RCV003982448 RCV003977162 RCV003913918 RCV003959824 RCV003964073 RCV003947002 RCV003971483 RCV003969452 RCV003925399 RCV003918111 RCV003980299 RCV003913001 RCV003906135
Uterine carcinosarcoma	Benign	rs61753379	RCV005901547
Uterine corpus endometrial carcinoma	Benign	rs61753379	RCV005901550
Uveal melanoma	Benign	rs61753379	RCV005901545
VATER association	Uncertain significance	rs769418685	RCV005414676

Show/Hide Text Mining Associations (47)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32092740
Adenoma	Stimulate	28177905
Breast Neoplasms	Associate	23735188, 33145341
Carcinogenesis	Associate	23747254, 26464709, 27662365
Carcinoma in Situ	Stimulate	28177905
Carcinoma Non Small Cell Lung	Associate	24567527
Carcinoma Ovarian Epithelial	Associate	26408177
Chronic Pain	Associate	26022780
Colitis Ulcerative	Associate	20828217
Colitis Ulcerative	Stimulate	25493016
Colonic Neoplasms	Associate	24113185, 36113636, 36273131
Colorectal Neoplasms	Associate	21979464, 23139614, 24113185, 24567527, 24962791, 25493016, 26071104, 26084290, 27662365, 28088229, 28177905, 31878280, 33025742, 33065966, 35543151, 36113636, 37796715, 39210159 View all (3 more)
Conversion Disorder	Associate	26022780
Esophageal Motility Disorders	Associate	26022780
Fatigue	Associate	26022780
Genetic Diseases Inborn	Associate	30887706
Glycosuria Renal	Associate	34338422
Hereditary Autoinflammatory Diseases	Associate	31882397
Hypoxia	Inhibit	31878280
Hypoxia	Associate	35543151
Hypoxia Brain	Associate	35543151
Inflammation	Associate	27206315
Kidney Diseases	Associate	28115289
Kidney Neoplasms	Associate	26722505
Lymphatic Metastasis	Stimulate	23139614, 26408177
Lymphatic Metastasis	Associate	26722505, 32092740
Lymphoma	Inhibit	35572591
Lymphopenia	Associate	39224595
Michelin tire baby syndrome	Associate	26022780
Nasopharyngeal Carcinoma	Associate	18570662
Neoplasm Metastasis	Inhibit	27977010
Neoplasm Metastasis	Associate	37165028
Neoplasms	Associate	18570662, 23735188, 24113185, 24962791, 26071104, 26408177, 26464709, 27662365, 27977010, 30260431, 30680959, 31878280, 33025742, 33065966, 34906113 View all (4 more)
Neoplasms	Stimulate	23747254, 26084290, 27206315
Neoplasms	Inhibit	28177905, 35393510, 37487647
Opportunistic Infections	Associate	39224595
Osteoarthritis	Associate	18784066
Ovarian Neoplasms	Associate	22978347, 27206315
Ovarian Neoplasms	Inhibit	27977010
Pain	Associate	26022780
Personality Disorders	Associate	37165028
Pneumonia Pneumocystis	Associate	39224595
Small Cell Lung Carcinoma	Associate	26464709
Squamous Cell Carcinoma of Head and Neck	Inhibit	34906113
Tertiary Lymphoid Structures	Associate	28088229, 31878280
VACTERL association	Associate	30887706, 34338422
VATER association	Associate	30887706, 34338422

TRAP1 (TNF receptor associated protein 1)