Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10127
Gene name	Zinc finger protein 263
Gene symbol	ZNF263
Synonyms (NCBI Gene)	FPM315ZKSCAN12ZSCAN44
Chromosome	16
Chromosome location	16p13.3

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026455	hsa-miR-192-5p	Sequencing	20371350
MIRT040352	hsa-miR-615-3p	CLASH	23622248
MIRT1519786	hsa-miR-1	CLIP-seq
MIRT1519787	hsa-miR-1258	CLIP-seq
MIRT1519788	hsa-miR-1295	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT1519790	hsa-miR-133a	CLIP-seq
MIRT1519791	hsa-miR-133b	CLIP-seq
MIRT1519792	hsa-miR-1343	CLIP-seq
MIRT1519793	hsa-miR-1587	CLIP-seq
MIRT1519794	hsa-miR-206	CLIP-seq
MIRT1519795	hsa-miR-216a	CLIP-seq
MIRT1519796	hsa-miR-216b	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519798	hsa-miR-3074-5p	CLIP-seq
MIRT1519799	hsa-miR-3124-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519801	hsa-miR-3613-3p	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT1519803	hsa-miR-3673	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519805	hsa-miR-3690	CLIP-seq
MIRT1519806	hsa-miR-378g	CLIP-seq
MIRT1519807	hsa-miR-3915	CLIP-seq
MIRT1519808	hsa-miR-3928	CLIP-seq
MIRT1519809	hsa-miR-4254	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq
MIRT1519811	hsa-miR-4328	CLIP-seq
MIRT1519812	hsa-miR-4436b-3p	CLIP-seq
MIRT1519813	hsa-miR-4492	CLIP-seq
MIRT1519814	hsa-miR-4498	CLIP-seq
MIRT1519815	hsa-miR-4529-5p	CLIP-seq
MIRT1519816	hsa-miR-4633-5p	CLIP-seq
MIRT1519817	hsa-miR-4656	CLIP-seq
MIRT1519818	hsa-miR-4675	CLIP-seq
MIRT1519819	hsa-miR-4717-5p	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519821	hsa-miR-4741	CLIP-seq
MIRT1519822	hsa-miR-4753-3p	CLIP-seq
MIRT1519823	hsa-miR-4761-3p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT1519825	hsa-miR-483-3p	CLIP-seq
MIRT1519826	hsa-miR-491-3p	CLIP-seq
MIRT1519827	hsa-miR-515-5p	CLIP-seq
MIRT1519828	hsa-miR-579	CLIP-seq
MIRT1519829	hsa-miR-613	CLIP-seq
MIRT1519830	hsa-miR-762	CLIP-seq
MIRT1519831	hsa-miR-885-5p	CLIP-seq
MIRT2156850	hsa-miR-1231	CLIP-seq
MIRT2156851	hsa-miR-125a-3p	CLIP-seq
MIRT2156852	hsa-miR-1279	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT2156853	hsa-miR-3130-3p	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT2156854	hsa-miR-3654	CLIP-seq
MIRT2156855	hsa-miR-3934	CLIP-seq
MIRT2156856	hsa-miR-4288	CLIP-seq
MIRT2156857	hsa-miR-4469	CLIP-seq
MIRT2156858	hsa-miR-4520a-3p	CLIP-seq
MIRT2156859	hsa-miR-4638-3p	CLIP-seq
MIRT2156860	hsa-miR-4649-3p	CLIP-seq
MIRT2156861	hsa-miR-4666-5p	CLIP-seq
MIRT2156862	hsa-miR-4699-3p	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT2156863	hsa-miR-4793-3p	CLIP-seq
MIRT2156864	hsa-miR-548ag	CLIP-seq
MIRT2156865	hsa-miR-548ai	CLIP-seq
MIRT2156866	hsa-miR-548g	CLIP-seq
MIRT2156867	hsa-miR-632	CLIP-seq
MIRT2156868	hsa-miR-764	CLIP-seq
MIRT2376506	hsa-miR-1305	CLIP-seq
MIRT1519789	hsa-miR-1324	CLIP-seq
MIRT1519795	hsa-miR-216a	CLIP-seq
MIRT1519802	hsa-miR-361-5p	CLIP-seq
MIRT2376507	hsa-miR-377	CLIP-seq
MIRT2376508	hsa-miR-4447	CLIP-seq
MIRT2376509	hsa-miR-4472	CLIP-seq
MIRT1519820	hsa-miR-4727-5p	CLIP-seq
MIRT1519824	hsa-miR-4769-3p	CLIP-seq
MIRT1519827	hsa-miR-515-5p	CLIP-seq
MIRT2376510	hsa-miR-552	CLIP-seq
MIRT2376511	hsa-miR-625	CLIP-seq
MIRT2376512	hsa-miR-873	CLIP-seq
MIRT2435022	hsa-miR-125a-5p	CLIP-seq
MIRT2435023	hsa-miR-125b	CLIP-seq
MIRT2435024	hsa-miR-3123	CLIP-seq
MIRT2435025	hsa-miR-3620	CLIP-seq
MIRT2435026	hsa-miR-3919	CLIP-seq
MIRT2435027	hsa-miR-4319	CLIP-seq
MIRT2435028	hsa-miR-544b	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq
MIRT1519797	hsa-miR-2467-3p	CLIP-seq
MIRT1519800	hsa-miR-3185	CLIP-seq
MIRT1519804	hsa-miR-3678-3p	CLIP-seq
MIRT1519810	hsa-miR-4257	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19887448, 32051553
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	32277030
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	32051553, 32277030
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19887448
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9256059
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 32051553, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	32051553
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	9256059
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	28473536
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	26089202
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
604191	13056	ENSG00000006194

O14978

Protein name

Zinc finger protein 263 (Zinc finger protein FPM315) (Zinc finger protein with KRAB and SCAN domains 12)

Protein function

Transcription factor that binds to the consensus sequence 5'-TCCTCCC-3' and acts as a transcriptional repressor (PubMed:32051553). Binds to the promoter region of SIX3 and recruits other proteins involved in chromatin modification and transcript

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02023	SCAN	37 → 125	SCAN domain	Domain
PF01352	KRAB	218 → 257	KRAB box	Family
PF00096	zf-C2H2	378 → 400	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	434 → 456	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	462 → 484	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	490 → 512	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	518 → 540	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	575 → 597	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	603 → 625	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	631 → 653	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	659 → 681	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte. {ECO:0000269|PubMed:9256059}.

Sequence

MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG

Sequence length

683

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	24819318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	27458175	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	34514002, 36035369	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	39294234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	32051553	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	31537905	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	39294234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	39294234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	39294234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	37065635	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF263 (zinc finger protein 263)